DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cisd2 and cisd1

DIOPT Version :9

Sequence 1:NP_651684.1 Gene:Cisd2 / 43459 FlyBaseID:FBgn0062442 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_001004811.1 Gene:cisd1 / 448057 XenbaseID:XB-GENE-973366 Length:103 Species:Xenopus tropicalis


Alignment Length:100 Identity:45/100 - (45%)
Similarity:65/100 - (65%) Gaps:5/100 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KDWLALIPPTVVVAGLGYTAYLAYCPAARASCAAKNSGRCNNHIRKNEPKVVDMIDVEDIAEKAA 98
            |:|.......|..|.:||.||.:.|  .:..|.   ..|.|..::|:.||||...|:||:.:||.
 Frog     6 KEWTTAASLVVATAAVGYIAYKSLC--CKDKC
C---KARVNPDLQKDNPKVVHAFDMEDLGDKAV 65

  Fly    99 FCRCWKTKNWPYCDGSHGEHNKQTGDNVGPIVIKK 133
            :||||::|.:|||||:|.:||::|||||||::|||
 Frog    66 YCRCWRSKKFPYCDGAHTKHNEETGDNVGPLIIKK 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cisd2NP_651684.1 MitoNEET_N 1..62 CDD:287613 9/27 (33%)
ZnF_CDGSH 83..121 CDD:197836 21/37 (57%)
cisd1NP_001004811.1 MitoNEET_N <4..35 CDD:313801 9/30 (30%)
ZnF_CDGSH 50..88 CDD:197836 21/37 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1393750at2759
OrthoFinder 1 1.000 - - FOG0002260
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13680
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4512
SonicParanoid 1 1.000 - - X1493
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.140

Return to query results.
Submit another query.