DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cisd2 and cisd1

DIOPT Version :9

Sequence 1:NP_651684.1 Gene:Cisd2 / 43459 FlyBaseID:FBgn0062442 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_956899.1 Gene:cisd1 / 393577 ZFINID:ZDB-GENE-040426-1162 Length:107 Species:Danio rerio


Alignment Length:102 Identity:38/102 - (37%)
Similarity:63/102 - (61%) Gaps:15/102 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LALIPPTVVVAGLGYTAYLAYCPAARASCAAKNSGRC-----NNHIRKNEPKVVDMIDVEDIAEK 96
            :|.:..|...|.:|...|..:.          ::.:|     |..::|:.||||...|:||:.:|
Zfish    13 IAAVSVTFGAAAVGLLVYKTFF----------HNSKCVKPKVNLDLQKDNPKVVHAFDIEDLGDK 67

  Fly    97 AAFCRCWKTKNWPYCDGSHGEHNKQTGDNVGPIVIKK 133
            |.:||||::|.:|:|||:|.:||::|||||||::||:
Zfish    68 AVYCRCWRSKKFPFCDGAHAKHNQETGDNVGPLIIKR 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cisd2NP_651684.1 MitoNEET_N 1..62 CDD:287613 5/24 (21%)
ZnF_CDGSH 83..121 CDD:197836 20/37 (54%)
cisd1NP_956899.1 ZnF_CDGSH 54..92 CDD:197836 20/37 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590044
Domainoid 1 1.000 48 1.000 Domainoid score I11931
eggNOG 1 0.900 - - E1_KOG3461
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1393750at2759
OrthoFinder 1 1.000 - - FOG0002260
OrthoInspector 1 1.000 - - otm25748
orthoMCL 1 0.900 - - OOG6_103419
Panther 1 1.100 - - LDO PTHR13680
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4512
SonicParanoid 1 1.000 - - X1493
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.740

Return to query results.
Submit another query.