DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cisd2 and cisd2

DIOPT Version :9

Sequence 1:NP_651684.1 Gene:Cisd2 / 43459 FlyBaseID:FBgn0062442 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_956677.1 Gene:cisd2 / 393354 ZFINID:ZDB-GENE-040426-1381 Length:135 Species:Danio rerio


Alignment Length:134 Identity:56/134 - (41%)
Similarity:85/134 - (63%) Gaps:5/134 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEPISHLVKSSLPNYLSSLPVPDSIGGWFKLSFKDWLALIPPTVVVAGLGYTAYLAYCPAARASC 65
            :|.||.::|..||.||..||:|::|||:.:|:..:||.|:|...::|.|||.....:.|..:   
Zfish     3 LESISKIIKIQLPAYLKKLPLPETIGGFARLTVSEWLRLLPLLGILALLGYLTIRPFLPKKK--- 64

  Fly    66 AAKNSGRCNNHIRKNEPKVVDMIDVEDI-AEKAAFCRCWKTKNWPYCDGSHGEHNKQTGDNVGPI 129
             .:.....|..|:|..||||:.||:||: .....:||||::|.:|.||.||.:||:.|||||||:
Zfish    65 -KQRDSLINLKIQKENPKVVNEIDIEDLRTPNVCYCRCWRSKTFPVCDKSHIKHNELTGDNVGPL 128

  Fly   130 VIKK 133
            ::||
Zfish   129 ILKK 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cisd2NP_651684.1 MitoNEET_N 1..62 CDD:287613 24/60 (40%)
ZnF_CDGSH 83..121 CDD:197836 19/38 (50%)
cisd2NP_956677.1 MitoNEET_N 3..66 CDD:287613 24/66 (36%)
ZnF_CDGSH 81..119 CDD:197836 18/37 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590043
Domainoid 1 1.000 55 1.000 Domainoid score I11164
eggNOG 1 0.900 - - E1_KOG3461
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H36436
Inparanoid 1 1.050 121 1.000 Inparanoid score I4744
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1393750at2759
OrthoFinder 1 1.000 - - FOG0002260
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103419
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4512
SonicParanoid 1 1.000 - - X1493
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.690

Return to query results.
Submit another query.