DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-c1L and cyc1

DIOPT Version :9

Sequence 1:NP_651683.1 Gene:Cyt-c1L / 43457 FlyBaseID:FBgn0039651 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_989234.1 Gene:cyc1 / 394843 XenbaseID:XB-GENE-6455900 Length:309 Species:Xenopus tropicalis


Alignment Length:306 Identity:169/306 - (55%)
Similarity:217/306 - (70%) Gaps:11/306 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RSLNSKLFQLAMSGIQRTSVRPR--ISFPGRGSGFTGNRKL-LGALGALTGTAGLLIYALETSVD 67
            |||...:.|   .|.....|.|:  :||    |..:..||: |..||.|......|.:||..||.
 Frog    10 RSLGGAVLQ---GGRAAWPVAPQANMSF----STLSRGRKVALSTLGILVAGGSGLAFALHQSVK 67

  Fly    68 ASSDCVHPAHQHWNHKGLLSALDKESVRRGYTVYKEVCSSCHSLQYMAYRNLVGVCMTEAEAKAE 132
            ||...:||....|:|.||||:||..|:||||.|||:||::|||::|:|:|||:||..|||||||.
 Frog    68 ASELELHPPSYPWSHNGLLSSLDHASIRRGYQVYKQVCAACHSMEYLAFRNLIGVSHTEAEAKAL 132

  Fly   133 AEAITVRDGPNEEGEYYERPGKLSDHFPSPYANEEAARSANNGSYPPDLSYIVSARKGGEDYVFS 197
            ||...:.|||:|.||.:.|||||||:||.||.|:||||::|||:.||||||||:||.||||||||
 Frog   133 AEEFEILDGPDENGEMFTRPGKLSDYFPKPYPNDEAARASNNGALPPDLSYIVNARHGGEDYVFS 197

  Fly   198 LLTGYCDPPAGFALRDGLYFNPYFSGGAIAMGKVVDNEVVSFEDPNVPASAAQIAKDVCVFLKWT 262
            |||||||||||.:||:|||:||||.|.|:.|...:.|||:.|:| ..||:.:|:|||||.||:|.
 Frog   198 LLTGYCDPPAGVSLREGLYYNPYFPGQAVGMAPPIYNEVLEFDD-GTPATMSQVAKDVCTFLRWA 261

  Fly   263 SEPETDERRLLLIKVTLISTFLIGISYYIKRFKWSTLKSRKIFFIP 308
            ||||.|:|:.:.:||.:||:.||.:.||:||.:||.||||||.:.|
 Frog   262 SEPEHDQRKRMGLKVLMISSILIPLIYYMKRHRWSVLKSRKIAYRP 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-c1LNP_651683.1 CYT1 73..300 CDD:225413 139/226 (62%)
Cytochrom_C1 80..299 CDD:280350 137/218 (63%)
cyc1NP_989234.1 Cytochrom_C1 80..296 CDD:366950 135/216 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 376 1.000 Inparanoid score I2045
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D439021at33208
OrthoFinder 1 1.000 - - FOG0003553
OrthoInspector 1 1.000 - - otm49053
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2430
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.