DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mesh1 and RSH3

DIOPT Version :9

Sequence 1:NP_651682.1 Gene:Mesh1 / 43456 FlyBaseID:FBgn0039650 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_564652.2 Gene:RSH3 / 841853 AraportID:AT1G54130 Length:715 Species:Arabidopsis thaliana


Alignment Length:158 Identity:47/158 - (29%)
Similarity:73/158 - (46%) Gaps:32/158 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 YAAFK-HRQQRRKDPQETPYVNHVINVSTILSVEACITDEG----VLMAALLHDVVEDTDASFED 74
            |.|.| ||.|.|....  ||:.|.:..:.:|:      |.|    |::|.:|||.::|:..|::.
plant   220 YEAEKAHRGQMRATGD--PYLQHCVETAMLLA------DIGANSTVVVAGILHDTLDDSFMSYDY 276

  Fly    75 VEKLFGPDVCGLVREVTDDKSLEKQERK-----------RLQIENAAKSSCRAKLIKLADKLDNL 128
            :.:.||..|..||..|:....|.|..|:           ||.....|.:..||.||||||:|.|:
plant   277 ILRTFGSGVADLVEGVSKLSQLSKLARENNTACKTVEADRLHTMFLAMADARAVLIKLADRLHNM 341

  Fly   129 RDLQVNTPTGWTQERRDQYFVWAKKVVD 156
            ..|....|.     :|.::   ||:.::
plant   342 MTLYALPPV-----KRQRF---AKETLE 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mesh1NP_651682.1 SpoT 13..>147 CDD:223394 45/147 (31%)
HD_4 13..136 CDD:290067 43/136 (32%)
RSH3NP_564652.2 SpoT 192..>554 CDD:223394 47/158 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 56 1.000 Domainoid score I4047
eggNOG 1 0.900 - - E1_COG0317
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002754
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.