DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mesh1 and RSH1

DIOPT Version :9

Sequence 1:NP_651682.1 Gene:Mesh1 / 43456 FlyBaseID:FBgn0039650 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_849287.2 Gene:RSH1 / 828096 AraportID:AT4G02260 Length:884 Species:Arabidopsis thaliana


Alignment Length:152 Identity:45/152 - (29%)
Similarity:71/152 - (46%) Gaps:29/152 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YPSAKFM---------ECLQYAAFKHRQQRRKDPQETPYVNHVINVSTIL-SVEACITDEGVLMA 58
            :||..::         :.|:.|...|..|:|:..:  |::.|.:.|:.|| .:|   .|...::|
plant   136 FPSISYLPRKELEFVQKGLKLAFEAHHGQKRRSGE--PFIIHPVAVARILGELE---LDWESIVA 195

  Fly    59 ALLHDVVEDTD-ASFEDVEKLFGPDVCGLVREVTDDKSLEKQERKR-------------LQIENA 109
            .||||.||||: .:||.:|:.||..|..:|...|....|.|.:.|.             .|:..|
plant   196 GLLHDTVEDTNFITFEKIEEEFGATVRHIVEGETKVSKLGKLKCKTESETIQDVKADDLRQMFLA 260

  Fly   110 AKSSCRAKLIKLADKLDNLRDL 131
            .....|..::||||:|.|:|.|
plant   261 MTDEVRVIIVKLADRLHNMRTL 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mesh1NP_651682.1 SpoT 13..>147 CDD:223394 43/134 (32%)
HD_4 13..136 CDD:290067 43/134 (32%)
RSH1NP_849287.2 SpoT 131..866 CDD:223394 45/152 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 56 1.000 Domainoid score I4047
eggNOG 1 0.900 - - E1_COG0317
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002754
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101946
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.670

Return to query results.
Submit another query.