DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mesh1 and CRSH

DIOPT Version :9

Sequence 1:NP_651682.1 Gene:Mesh1 / 43456 FlyBaseID:FBgn0039650 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001327079.1 Gene:CRSH / 821012 AraportID:AT3G17470 Length:598 Species:Arabidopsis thaliana


Alignment Length:150 Identity:37/150 - (24%)
Similarity:64/150 - (42%) Gaps:21/150 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VSTILSVEACIT----DEGVLMAALLHDVVEDTDASFEDVEKLFGPDVCGLVREVTDDKS----- 95
            :|..||:...:.    |..|:.|::|.:||:....|..:|....|.....|:.|:...|:     
plant   128 LSKALSLSIILADLQMDAEVISASILSEVVDANAISIYEVRDHIGTGTAHLLHEIFRVKNIPFKV 192

  Fly    96 --LEKQERKRLQIENAAKSSCRAKLIKLADKLDNLRDLQVNTPTGWTQERRDQYFVWAKKVVDNL 158
              |:.:....|:.........||.::.|..|||.:|.|. :.|    :.|:....:...|:...|
plant   193 DVLDDETAASLRKFYLTYYDIRAVIMDLVSKLDEMRHLD-HLP----RYRQQILSLEVLKIYSPL 252

  Fly   159 R---GTNANLELKLDEI-FR 174
            .   |.| :|.|:|::| ||
plant   253 AHAVGAN-HLSLELEDISFR 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mesh1NP_651682.1 SpoT 13..>147 CDD:223394 27/117 (23%)
HD_4 13..136 CDD:290067 25/106 (24%)
CRSHNP_001327079.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0317
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002754
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.