DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mesh1 and RSH2

DIOPT Version :9

Sequence 1:NP_651682.1 Gene:Mesh1 / 43456 FlyBaseID:FBgn0039650 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_188021.1 Gene:RSH2 / 820619 AraportID:AT3G14050 Length:709 Species:Arabidopsis thaliana


Alignment Length:155 Identity:49/155 - (31%)
Similarity:76/155 - (49%) Gaps:26/155 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 YAAFK-HRQQRRKDPQETPYVNHVINVSTIL-SVEACITDEGVLMAALLHDVVEDTDASFEDVEK 77
            |.|.| ||.|.|  ....||:.|.:..:.:| ::.|..|   |::|.||||.::|:..|::.:.:
plant   216 YEAEKAHRGQMR--ASRDPYLQHCVETAMLLANIGANST---VVVAGLLHDTIDDSFMSYDYILR 275

  Fly    78 LFGPDVCGLVREVTDDKSLEKQERK-----------RLQIENAAKSSCRAKLIKLADKLDNLRDL 131
            .||..|..||..|:....|.|..|:           ||.....|.:..||.||||||:|.|::.|
plant   276 NFGAGVADLVEGVSKLSQLSKLARENNTACKTVEADRLHTMFLAMADARAVLIKLADRLHNMKTL 340

  Fly   132 QVNTPTGWTQERRDQYFVWAKKVVD 156
            ...:|.  .|:|      :||:.::
plant   341 YALSPV--KQQR------FAKETLE 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mesh1NP_651682.1 SpoT 13..>147 CDD:223394 47/144 (33%)
HD_4 13..136 CDD:290067 44/133 (33%)
RSH2NP_188021.1 SpoT 190..>550 CDD:223394 49/155 (32%)
HD_4 214..368 CDD:290067 49/155 (32%)
RelA_SpoT 427..537 CDD:282463
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 56 1.000 Domainoid score I4047
eggNOG 1 0.900 - - E1_COG0317
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002754
OrthoInspector 1 1.000 - - oto4156
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.770

Return to query results.
Submit another query.