DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mesh1 and hddc3

DIOPT Version :9

Sequence 1:NP_651682.1 Gene:Mesh1 / 43456 FlyBaseID:FBgn0039650 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001017835.1 Gene:hddc3 / 550533 ZFINID:ZDB-GENE-050417-377 Length:180 Species:Danio rerio


Alignment Length:173 Identity:97/173 - (56%)
Similarity:125/173 - (72%) Gaps:0/173 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SAKFMECLQYAAFKHRQQRRKDPQETPYVNHVINVSTILSVEACITDEGVLMAALLHDVVEDTDA 70
            :|..:|.:.:||.|||.||.|||:.|||:||.|.|:.|||.|..|||..|:.||||||.|||||.
Zfish     6 TAVLLETVNFAAEKHRNQRHKDPEGTPYINHPIGVARILSHEGEITDVEVIQAALLHDTVEDTDT 70

  Fly    71 SFEDVEKLFGPDVCGLVREVTDDKSLEKQERKRLQIENAAKSSCRAKLIKLADKLDNLRDLQVNT 135
            :||::|.:||..|..:|:.|||||||.|.||:|.|:|:|...|.:|||:||||||.|||||...|
Zfish    71 TFEELESVFGATVARIVQGVTDDKSLPKAERERQQVEHAPHCSHQAKLVKLADKLYNLRDLNRCT 135

  Fly   136 PTGWTQERRDQYFVWAKKVVDNLRGTNANLELKLDEIFRQRGL 178
            |.||:.:|..:||.||.:||..||||||.:|.||.::|.:||:
Zfish   136 PEGWSAQRVQEYFEWASQVVKGLRGTNAAIEEKLQQLFLERGV 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mesh1NP_651682.1 SpoT 13..>147 CDD:223394 77/133 (58%)
HD_4 13..136 CDD:290067 72/122 (59%)
hddc3NP_001017835.1 SpoT 9..>138 CDD:223394 75/128 (59%)
HD_4 13..139 CDD:290067 74/125 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593129
Domainoid 1 1.000 149 1.000 Domainoid score I4398
eggNOG 1 0.900 - - E1_COG0317
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12279
Inparanoid 1 1.050 192 1.000 Inparanoid score I3852
OMA 1 1.010 - - QHG63160
OrthoDB 1 1.010 - - D1372331at2759
OrthoFinder 1 1.000 - - FOG0002754
OrthoInspector 1 1.000 - - oto38609
orthoMCL 1 0.900 - - OOG6_101946
Panther 1 1.100 - - LDO PTHR46246
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4722
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.