DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mesh1 and ZK909.3

DIOPT Version :9

Sequence 1:NP_651682.1 Gene:Mesh1 / 43456 FlyBaseID:FBgn0039650 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_493608.2 Gene:ZK909.3 / 191461 WormBaseID:WBGene00014148 Length:229 Species:Caenorhabditis elegans


Alignment Length:166 Identity:81/166 - (48%)
Similarity:117/166 - (70%) Gaps:1/166 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MECLQYAAFKHRQQRRKDPQETPYVNHVINVSTILSVEACITDEGVLMAALLHDVVEDTDASFED 74
            ::...:||.:||.|:||| ..|||:||.|.|..||:.||.:.|...|.||:||||||||..:.|:
 Worm    62 LKATDFAARRHRHQKRKD-NATPYINHPIGVMYILTNEAKVYDPVTLAAAVLHDVVEDTKTTPEE 125

  Fly    75 VEKLFGPDVCGLVREVTDDKSLEKQERKRLQIENAAKSSCRAKLIKLADKLDNLRDLQVNTPTGW 139
            :::.||.:|..:|:|.||||:|.|.|||:|||||..|.|.:|||:.|||||.|||||:...|.||
 Worm   126 IQQEFGNEVFQVVKECTDDKNLAKAERKKLQIENYGKHSHQAKLVHLADKLYNLRDLERKAPIGW 190

  Fly   140 TQERRDQYFVWAKKVVDNLRGTNANLELKLDEIFRQ 175
            .::|.::||.|:::|:..::|||.:||..||::..:
 Worm   191 DKKRVNEYFKWSREVIGEMKGTNESLEYALDDVINR 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mesh1NP_651682.1 SpoT 13..>147 CDD:223394 70/133 (53%)
HD_4 13..136 CDD:290067 66/122 (54%)
ZK909.3NP_493608.2 SpoT 61..>204 CDD:223394 73/142 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165446
Domainoid 1 1.000 123 1.000 Domainoid score I3464
eggNOG 1 0.900 - - E1_COG0317
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12279
Inparanoid 1 1.050 163 1.000 Inparanoid score I2830
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63160
OrthoDB 1 1.010 - - D1372331at2759
OrthoFinder 1 1.000 - - FOG0002754
OrthoInspector 1 1.000 - - oto18626
orthoMCL 1 0.900 - - OOG6_101946
Panther 1 1.100 - - LDO PTHR46246
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3518
SonicParanoid 1 1.000 - - X4722
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.