DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14515 and l(2)34Fc

DIOPT Version :9

Sequence 1:NP_651681.2 Gene:CG14515 / 43454 FlyBaseID:FBgn0039648 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001285930.1 Gene:l(2)34Fc / 34838 FlyBaseID:FBgn0261534 Length:159 Species:Drosophila melanogaster


Alignment Length:174 Identity:54/174 - (31%)
Similarity:71/174 - (40%) Gaps:37/174 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FKWLSLELLLLIGAAVAFPDGAPADTCVKQRANQPNHGKARSQPAHSNPYEVVADAQTYHPGQQI 69
            |:.|.|...|.| :..|:.||||...|   |...|.||               |..|...|...|
  Fly     2 FRLLVLAACLAI-SVHAYSDGAPKAAC---RDLTPQHG---------------AKLQVTKPPYSI 47

  Fly    70 SVVIYPHSDQSTV-------FRGFFLQARDANSNEWIGEW--VQSENTKTIPECS----AITH-S 120
            |...:..|||...       |.||.:|||| ..|..:|::  |.|.:::|: :||    .||| |
  Fly    48 SGPSHVRSDQKLTLTLGGDEFLGFMIQARD-GQNRVVGQFQVVDSVHSQTL-DCSGKDDTITHLS 110

  Fly   121 DNRDK--LGAKLIWKAPQNKRGQVYFTGTVLQEYGTFWSDIVNK 162
            ..:.|  .|....|..|...:|.|.|..||:|....:|...|.|
  Fly   111 AQKGKPLTGITFDWIPPAGYKGNVKFMATVVQTGFVYWVGRVTK 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14515NP_651681.2 Reeler 30..163 CDD:260081 44/149 (30%)
l(2)34FcNP_001285930.1 Reeler 27..149 CDD:280232 41/141 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446186
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45828
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3670
SonicParanoid 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.