DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14515 and REELD1

DIOPT Version :10

Sequence 1:NP_651681.2 Gene:CG14515 / 43454 FlyBaseID:FBgn0039648 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001341560.1 Gene:REELD1 / 345051 HGNCID:53638 Length:526 Species:Homo sapiens


Alignment Length:161 Identity:48/161 - (29%)
Similarity:73/161 - (45%) Gaps:15/161 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLLIGAAVAFPDGAPADTCVKQRANQPNHGKARSQPAHSNPYEVVADAQ--TYHPGQQISVVIYP 75
            |.|...:.||..||....|...   ||.|  .::||.|.:.:.:.....  :|.||.:|.|.:..
Human    15 LCLASCSSAFSHGASTVACDDM---QPKH--IQAQPQHQDSHHITIHTHRTSYAPGDKIPVTVRS 74

  Fly    76 HSDQSTVFRGFFLQARDANSNEWIGEWV----QSENTKTIPECSAITHSDNRDKLGAKLIWKAPQ 136
            ..|    |.||.||||..:.::..|.:|    .|:......|..|:||||...|.....:||||.
Human    75 SRD----FMGFLLQARRVSDHQIAGTFVLIPPHSKLMTCFQEADAVTHSDKSLKRNLSFVWKAPA 135

  Fly   137 NKRGQVYFTGTVLQEYGTFWSDIVNKVQAER 167
            ...|.:.|..:|:|.|..:|:.|.:.|.:::
Human   136 QPVGDIKFLLSVVQSYFVYWARIESSVVSQQ 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14515NP_651681.2 Reeler 30..163 CDD:260081 41/138 (30%)
REELD1NP_001341560.1 Reeler 33..155 CDD:460411 39/130 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..272
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 294..336
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 370..398
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.