DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14515 and REELD1

DIOPT Version :9

Sequence 1:NP_651681.2 Gene:CG14515 / 43454 FlyBaseID:FBgn0039648 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001341560.1 Gene:REELD1 / 345051 HGNCID:53638 Length:526 Species:Homo sapiens


Alignment Length:161 Identity:48/161 - (29%)
Similarity:73/161 - (45%) Gaps:15/161 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLLIGAAVAFPDGAPADTCVKQRANQPNHGKARSQPAHSNPYEVVADAQ--TYHPGQQISVVIYP 75
            |.|...:.||..||....|...   ||.|  .::||.|.:.:.:.....  :|.||.:|.|.:..
Human    15 LCLASCSSAFSHGASTVACDDM---QPKH--IQAQPQHQDSHHITIHTHRTSYAPGDKIPVTVRS 74

  Fly    76 HSDQSTVFRGFFLQARDANSNEWIGEWV----QSENTKTIPECSAITHSDNRDKLGAKLIWKAPQ 136
            ..|    |.||.||||..:.::..|.:|    .|:......|..|:||||...|.....:||||.
Human    75 SRD----FMGFLLQARRVSDHQIAGTFVLIPPHSKLMTCFQEADAVTHSDKSLKRNLSFVWKAPA 135

  Fly   137 NKRGQVYFTGTVLQEYGTFWSDIVNKVQAER 167
            ...|.:.|..:|:|.|..:|:.|.:.|.:::
Human   136 QPVGDIKFLLSVVQSYFVYWARIESSVVSQQ 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14515NP_651681.2 Reeler 30..163 CDD:260081 41/138 (30%)
REELD1NP_001341560.1 Reeler 33..155 CDD:366876 39/130 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..272
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 294..336
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 370..398
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141362
Domainoid 1 1.000 65 1.000 Domainoid score I10072
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009692
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_111875
Panther 1 1.100 - - O PTHR45828
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.