DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14515 and Frrs1

DIOPT Version :9

Sequence 1:NP_651681.2 Gene:CG14515 / 43454 FlyBaseID:FBgn0039648 Length:168 Species:Drosophila melanogaster
Sequence 2:XP_038959758.1 Gene:Frrs1 / 310810 RGDID:1306883 Length:592 Species:Rattus norvegicus


Alignment Length:159 Identity:49/159 - (30%)
Similarity:75/159 - (47%) Gaps:21/159 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLIGAAVAFPDGAPADTCVKQRANQPNHGKARSQPAHSNPYEVVADAQTYHPGQQISVVIYPHSD 78
            |||.:..|:|:|..|.:|... ..|.|| ..:|.|.|    ::......:.||.||.|.:     
  Rat    15 LLICSVTAYPNGRVARSCAGM-IPQHNH-SPQSDPVH----KITVSQMKFKPGDQIKVTL----- 68

  Fly    79 QSTVFRGFFLQARDAN--SNEWIGEW--VQSENTKTIPECS-----AITHSDNRDKLGAKLIWKA 134
            ....||||.|:||:|.  |...||.:  :.|:::: |..|.     |::|:.:..|...|:.|.|
  Rat    69 SGPPFRGFLLEARNAEDLSGPPIGTFTLIDSDSSQ-ILTCEDVQGFAVSHTSSSIKTEIKVYWNA 132

  Fly   135 PQNKRGQVYFTGTVLQEYGTFWSDIVNKV 163
            |.:....|.|..||:|:|..:|..|...|
  Rat   133 PSSAPDHVQFLATVVQKYKIYWVKIPGPV 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14515NP_651681.2 Reeler 30..163 CDD:260081 41/141 (29%)
Frrs1XP_038959758.1 Reeler 32..155 CDD:396550 39/134 (29%)
DOMON_SDR_2_like 192..354 CDD:187686
Cyt_b561_FRRS1_like 320..533 CDD:176490
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335032
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45828
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.