DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14515 and Frrs1l

DIOPT Version :9

Sequence 1:NP_651681.2 Gene:CG14515 / 43454 FlyBaseID:FBgn0039648 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001136437.1 Gene:Frrs1l / 230235 MGIID:2442704 Length:293 Species:Mus musculus


Alignment Length:161 Identity:35/161 - (21%)
Similarity:52/161 - (32%) Gaps:49/161 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WLSLELLLLIGAAVAFPDGAPADTCVKQRANQPNHGKARSQ-------PAHSNPYEVVADAQTYH 64
            |:.|.|.||: |.:|..|.:|||.........| .|:||..       |.|.:.|...  |..::
Mouse    11 WVPLLLRLLL-AGIAACDASPADDSAGPGGRGP-RGRARGDAGADEAVPRHDSSYGTF--ASEFY 71

  Fly    65 PGQQISVVIYPHSDQSTV-----------------FR-----------GFFLQAR---------- 91
            ..:.:|...||......|                 ||           .:||..|          
Mouse    72 DLRYLSEEGYPFPTAPPVDPFAKIKVEDCGRTKGCFRYGKPGCNAETCDYFLSYRMIGADVEFEL 136

  Fly    92 DANSNEWIGEWVQSENTKTIPECSAITHSDN 122
            .|:::.|:.....|:......:..|..|.||
Mouse   137 SADTDGWVAVGFSSDKKMGGDDVMACVHDDN 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14515NP_651681.2 Reeler 30..163 CDD:260081 24/138 (17%)
Frrs1lNP_001136437.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..60 8/31 (26%)
DOMON_SDR_2_like 94..253 CDD:187686 12/74 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831297
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.