DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14515 and Y57G11A.4

DIOPT Version :9

Sequence 1:NP_651681.2 Gene:CG14515 / 43454 FlyBaseID:FBgn0039648 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_502754.3 Gene:Y57G11A.4 / 190363 WormBaseID:WBGene00013292 Length:262 Species:Caenorhabditis elegans


Alignment Length:169 Identity:43/169 - (25%)
Similarity:63/169 - (37%) Gaps:41/169 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FKWLSLELLLLIGAAVAFPDGAPADT---CV-KQRANQPN----HGKARSQPAHSNPYEVVADAQ 61
            |..|.:.||..:..|: |.|.....|   |: :.|...||    .|.|.|..| .|..:|...|.
 Worm     4 FALLVVSLLANLADAI-FIDSTGCGTTKMCMFRPRGCDPNLDCTIGVALSVIA-PNRMKVQMVAA 66

  Fly    62 TYHPG--QQISVVIYPHSDQSTVFRGFFLQARDANSNEWIGEWVQSENTKTIPECSAITHSDNRD 124
            |..|.  ||...:.:.|..    |.|....:....||  :||:|..|     ||   :..|.|:.
 Worm    67 TIVPAVQQQYVAIAFSHDK----FMGNDSVSECVISN--MGEFVGFE-----PE---VYVSYNKG 117

  Fly   125 KLGAKLIWKAPQNKRGQVYFTGTVLQEYGTFWSDIVNKV 163
            |          .|.|  |:...   .|:...::|:.::|
 Worm   118 K----------SNDR--VFLND---DEHAEMFTDLASEV 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14515NP_651681.2 Reeler 30..163 CDD:260081 35/142 (25%)
Y57G11A.4NP_502754.3 DOMON_SDR_2_like 21..200 CDD:187686 37/151 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156362
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45828
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.