DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14515 and F23B12.4

DIOPT Version :9

Sequence 1:NP_651681.2 Gene:CG14515 / 43454 FlyBaseID:FBgn0039648 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001122926.2 Gene:F23B12.4 / 179944 WormBaseID:WBGene00009081 Length:370 Species:Caenorhabditis elegans


Alignment Length:175 Identity:53/175 - (30%)
Similarity:79/175 - (45%) Gaps:29/175 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LELLLLIGAAVAFPDGAPADTCVKQRANQPN------H--GKARSQPAHSNPYEVVADAQTYHPG 66
            |.|:.|:...||:|||||   ||.......|      |  |...|.|    |||:..|.:.|...
 Worm     6 LFLVALVPVVVAWPDGAP---CVHAAFESMNPLEAVEHQGGLQLSTP----PYEIAVDQKCYWRN 63

  Fly    67 QQISVVIYPHSDQSTVFRGFFLQARDANSN---EWIGEWVQ-SENTKTIPEC----SAITHSDNR 123
            |.|.:.:..| ::|..|:||.:|....|::   |..|:.|: .:|.....:|    .:.|||.:.
 Worm    64 QPIGLTLQGH-NESIWFKGFVIQPFKWNNDQLGERFGQLVRLDDNGSWQQQCFRYQVSATHSHDE 127

  Fly   124 DKLGAKLIWKAPQNKRGQVYFTGTVLQEYGTFWSDIVNKVQAERP 168
            .|...|:.||. .::...|.|..||::....||   |..|:: ||
 Worm   128 KKKHIKMWWKV-DDEVDTVQFVATVVKHQTQFW---VKSVRS-RP 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14515NP_651681.2 Reeler 30..163 CDD:260081 40/148 (27%)
F23B12.4NP_001122926.2 Reeler 40..169 CDD:260081 40/138 (29%)
ShK 330..367 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45828
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.