powered by:
Protein Alignment CG14515 and C05D12.1
DIOPT Version :9
Sequence 1: | NP_651681.2 |
Gene: | CG14515 / 43454 |
FlyBaseID: | FBgn0039648 |
Length: | 168 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_496432.2 |
Gene: | C05D12.1 / 174740 |
WormBaseID: | WBGene00007339 |
Length: | 498 |
Species: | Caenorhabditis elegans |
Alignment Length: | 58 |
Identity: | 15/58 - (25%) |
Similarity: | 25/58 - (43%) |
Gaps: | 9/58 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 SNPYEVVADAQTYHPGQQISVVIYPHSDQSTVFRGFFLQARDANSNEW-IGEWVQSEN 107
:|.|.:..|..:.:.||| :|......| .|.:...::.|.: |||..|:.|
Worm 183 ANKYTLEKDIHSTNDGQQ-----FPWMSDEQV---SFCRTNCSSPNLYHIGEMRQTYN 232
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160156365 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR45828 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R3670 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 3.060 |
|
Return to query results.
Submit another query.