DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14515 and C05D12.1

DIOPT Version :9

Sequence 1:NP_651681.2 Gene:CG14515 / 43454 FlyBaseID:FBgn0039648 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_496432.2 Gene:C05D12.1 / 174740 WormBaseID:WBGene00007339 Length:498 Species:Caenorhabditis elegans


Alignment Length:58 Identity:15/58 - (25%)
Similarity:25/58 - (43%) Gaps:9/58 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 SNPYEVVADAQTYHPGQQISVVIYPHSDQSTVFRGFFLQARDANSNEW-IGEWVQSEN 107
            :|.|.:..|..:.:.|||     :|......|   .|.:...::.|.: |||..|:.|
 Worm   183 ANKYTLEKDIHSTNDGQQ-----FPWMSDEQV---SFCRTNCSSPNLYHIGEMRQTYN 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14515NP_651681.2 Reeler 30..163 CDD:260081 15/58 (26%)
C05D12.1NP_496432.2 DOMON_SDR_2_like 24..205 CDD:187686 7/26 (27%)
Cyt_b561_FRRS1_like 217..419 CDD:176490 6/16 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156365
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45828
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3670
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.