DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14515 and M03A1.3

DIOPT Version :9

Sequence 1:NP_651681.2 Gene:CG14515 / 43454 FlyBaseID:FBgn0039648 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_494805.3 Gene:M03A1.3 / 173791 WormBaseID:WBGene00019746 Length:352 Species:Caenorhabditis elegans


Alignment Length:107 Identity:19/107 - (17%)
Similarity:40/107 - (37%) Gaps:20/107 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 GQQISVVIYPHSDQSTVFRGFFLQAR------DANSNEWIGEWVQSENT-----KTIPECSAITH 119
            |..:::.||  .:.|.:.:...||..      |..:.:..|:..:::.|     |.:|....::.
 Worm    42 GDSLNLRIY--DENSAIRKVHILQKEGKDVLVDCTNKKEDGKTCEAQLTVDQFEKNLPISIKLSD 104

  Fly   120 SDNRDKLGAKLIWKAPQ-----NKRGQVYFTGTVLQEYGTFW 156
            |...|.:..:.:....|     .:|.|......:|..:|  |
 Worm   105 SQTSDPISLEALVPPAQEGLTKQQRRQFSKAHAILMIFG--W 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14515NP_651681.2 Reeler 30..163 CDD:260081 19/107 (18%)
M03A1.3NP_494805.3 Cyt_b561_FRRS1_like 99..305 CDD:176490 8/48 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156359
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.