DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14515 and LOC108179094

DIOPT Version :9

Sequence 1:NP_651681.2 Gene:CG14515 / 43454 FlyBaseID:FBgn0039648 Length:168 Species:Drosophila melanogaster
Sequence 2:XP_021327713.1 Gene:LOC108179094 / 108179094 -ID:- Length:546 Species:Danio rerio


Alignment Length:153 Identity:41/153 - (26%)
Similarity:69/153 - (45%) Gaps:14/153 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLLIGAAV-----AFPDGA-PADTCVKQRANQPNHGKARSQPAHSNPYEVVADAQTYHPGQQIS 70
            |||:.|..:     .:.||: ..|.|   ::...:|| .::....|||:.|:.|..|.:..|..:
Zfish     8 LLLIFGFTMLKFICCYSDGSLLTDQC---QSMAIDHG-VQASGQDSNPFTVIPDNVTVNSSQVGT 68

  Fly    71 VVIYPHSDQSTVFRGFFLQARDANSNEWIGEW--VQSENTKTIPECSAITHSDNRDKLGAKLIWK 133
            .:....|..|..|.|:.|:||:.::....|.:  :.|.|:..:....|:.|.:|.||....:.| 
Zfish    69 GITVTLSTSSVPFLGYMLEARECDNCPPAGTFSGIDSANSLLLCGDQAVAHPNNNDKTSVLVTW- 132

  Fly   134 APQNKRGQVYFTGTVLQEYGTFW 156
            .|| ..||.||....:|.:...|
Zfish   133 TPQ-ATGQFYFRAAFVQTFSFGW 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14515NP_651681.2 Reeler 30..163 CDD:260081 34/129 (26%)
LOC108179094XP_021327713.1 Reeler 33..151 CDD:307916 33/123 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45828
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.