DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14515 and frrs1l

DIOPT Version :9

Sequence 1:NP_651681.2 Gene:CG14515 / 43454 FlyBaseID:FBgn0039648 Length:168 Species:Drosophila melanogaster
Sequence 2:XP_003200244.1 Gene:frrs1l / 100536668 -ID:- Length:282 Species:Danio rerio


Alignment Length:89 Identity:19/89 - (21%)
Similarity:26/89 - (29%) Gaps:40/89 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DRFKWLSLELLLLIGAAVAFPDGAPADTCVKQRANQPNHGKARSQPAHSNPYEVVADAQTYHPGQ 67
            |...||::             ..:|.|..| .||....||    :|.|..               
Zfish    15 DATLWLAV-------------SASPTDDNV-LRAGHGEHG----EPGHEE--------------- 46

  Fly    68 QISVVIYPHSDQSTVFRGFFLQAR 91
                   ||.|..:.|...||::|
Zfish    47 -------PHKDSYSTFASEFLESR 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14515NP_651681.2 Reeler 30..163 CDD:260081 14/62 (23%)
frrs1lXP_003200244.1 DOMON_SDR_2_like 83..235 CDD:187686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574261
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.