powered by:
Protein Alignment CG14515 and frrs1l
DIOPT Version :9
Sequence 1: | NP_651681.2 |
Gene: | CG14515 / 43454 |
FlyBaseID: | FBgn0039648 |
Length: | 168 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_003200244.1 |
Gene: | frrs1l / 100536668 |
-ID: | - |
Length: | 282 |
Species: | Danio rerio |
Alignment Length: | 89 |
Identity: | 19/89 - (21%) |
Similarity: | 26/89 - (29%) |
Gaps: | 40/89 - (44%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 DRFKWLSLELLLLIGAAVAFPDGAPADTCVKQRANQPNHGKARSQPAHSNPYEVVADAQTYHPGQ 67
|...||:: ..:|.|..| .||....|| :|.|..
Zfish 15 DATLWLAV-------------SASPTDDNV-LRAGHGEHG----EPGHEE--------------- 46
Fly 68 QISVVIYPHSDQSTVFRGFFLQAR 91
||.|..:.|...||::|
Zfish 47 -------PHKDSYSTFASEFLESR 63
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG14515 | NP_651681.2 |
Reeler |
30..163 |
CDD:260081 |
14/62 (23%) |
frrs1l | XP_003200244.1 |
DOMON_SDR_2_like |
83..235 |
CDD:187686 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170574261 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.