DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14515 and LOC100489839

DIOPT Version :9

Sequence 1:NP_651681.2 Gene:CG14515 / 43454 FlyBaseID:FBgn0039648 Length:168 Species:Drosophila melanogaster
Sequence 2:XP_017949106.2 Gene:LOC100489839 / 100489839 -ID:- Length:550 Species:Xenopus tropicalis


Alignment Length:164 Identity:45/164 - (27%)
Similarity:68/164 - (41%) Gaps:22/164 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSLELLLL----IGAAVAFPDG---APADTCVKQRANQPNHGKARSQPAHSNPYEVVADAQTYHP 65
            :...||:|    ..:..:||.|   |..||.:      |.|..:..|.. ::||.:.....|:..
 Frog     1 MEARLLVLFSGYFASVFSFPSGQISASCDTML------PQHRGSTPQTT-ASPYFITVSNTTFKS 58

  Fly    66 GQQISVVIYPHSDQSTVFRGFFLQARDANSNEWIGEWVQSENTKTIPEC-----SAITHSDNRDK 125
            |..|:|.|  .|:....|:||.|:|.....:...|.:..:........|     ||::|:.:..|
 Frog    59 GDSITVTI--QSNSGNTFKGFLLEALSVGGDTATGTFTITNGDTQGLSCSAGPNSAVSHTSDSSK 121

  Fly   126 LGAKLIWKAPQNKRGQVYFTGTVLQEYGTFWSDI 159
            ......|.||.. .|.|.|..||||.:.||||.:
 Frog   122 SSVTTSWTAPSG-AGPVRFRATVLQGFSTFWSGV 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14515NP_651681.2 Reeler 30..163 CDD:260081 37/135 (27%)
LOC100489839XP_017949106.2 Reeler 28..151 CDD:396550 35/132 (27%)
DOMON_SDR_2_like 169..327 CDD:187686
Cyt_b561_FRRS1_like 292..505 CDD:176490
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.