DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14515 and reeld1

DIOPT Version :9

Sequence 1:NP_651681.2 Gene:CG14515 / 43454 FlyBaseID:FBgn0039648 Length:168 Species:Drosophila melanogaster
Sequence 2:XP_031751366.1 Gene:reeld1 / 100485235 -ID:- Length:524 Species:Xenopus tropicalis


Alignment Length:176 Identity:49/176 - (27%)
Similarity:77/176 - (43%) Gaps:16/176 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKDRFK-----WLSLELLLLIGAAVAFPDGAPADTCVKQRANQPNHGKARSQPAHSNPYEVVADA 60
            ::||.|     .|:...:.||..:.||..||....|...|   |.|.:|:.|....|...:..:.
 Frog    27 VEDRIKAQLCLGLACASVCLISYSAAFSHGASLSACSDMR---PKHIRAQPQNPKKNYIAIRTNR 88

  Fly    61 QTYHPGQQISVVIYPHSDQSTVFRGFFLQARDANSNEWIGEWVQSENTKTIPEC----SAITHSD 121
            .:|.||..:.|.|....|    |.||.||||..::::..|.:|.......:..|    ..:||||
 Frog    89 TSYLPGDTVPVTIRSSRD----FMGFLLQARRISNDQVAGSFVFIPPGAKLLHCFEDGDTVTHSD 149

  Fly   122 NRDKLGAKLIWKAPQNKRGQVYFTGTVLQEYGTFWSDIVNKVQAER 167
            ...|.....:||:|....|.:.|..:|:|.|..:||.|.:.:.:.:
 Frog   150 KSLKRNLSFVWKSPDQPVGDIRFFLSVVQSYFVYWSRIESAIVSSK 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14515NP_651681.2 Reeler 30..163 CDD:260081 39/136 (29%)
reeld1XP_031751366.1 Reeler 62..184 CDD:396550 36/128 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009692
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45828
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.