DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14515 and zgc:163022

DIOPT Version :9

Sequence 1:NP_651681.2 Gene:CG14515 / 43454 FlyBaseID:FBgn0039648 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001083026.2 Gene:zgc:163022 / 100038777 ZFINID:ZDB-GENE-070424-101 Length:570 Species:Danio rerio


Alignment Length:154 Identity:46/154 - (29%)
Similarity:76/154 - (49%) Gaps:13/154 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLLIGAAVAFPDGAPADTCVKQRANQPNHGKARSQPAHSNPYEVVADAQTYHPGQQISVVIYPH 76
            |:|.:|...::.:|..::.|   .:..|||| |.:|.: |.|:.|.||..|:..|.||.|.:  :
Zfish    15 LVLCVGLVQSYKNGLVSEVC---DSMMPNHG-ANAQTS-SPPFTVTADKTTFKEGDQIKVTL--N 72

  Fly    77 SDQSTVFRGFFLQARDANSNEWIGEWVQSENTKTIPECS-----AITHSDNRDKLGAKLIWKAP- 135
            |.....|.||.||||...|:..||.:..:.|...:..|:     |::|:.|......::.|.|| 
Zfish    73 SQTGYYFEGFMLQARPVGSSSTIGTFSVTGNNVQVLSCNGMPGRAVSHTSNAKTTSVQVTWTAPT 137

  Fly   136 QNKRGQVYFTGTVLQEYGTFWSDI 159
            ..:.|.:.|:.|.::...|||..:
Zfish   138 SGQLGNIEFSVTFVKSTLTFWVQV 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14515NP_651681.2 Reeler 30..163 CDD:260081 42/136 (31%)
zgc:163022NP_001083026.2 Reeler 34..159 CDD:307916 41/131 (31%)
DOMON_SDR_2_like 186..343 CDD:187686
Cyt_b561_FRRS1_like 314..525 CDD:176490
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574270
Domainoid 1 1.000 60 1.000 Domainoid score I10552
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45828
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.