DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14515 and si:ch73-14h1.2

DIOPT Version :9

Sequence 1:NP_651681.2 Gene:CG14515 / 43454 FlyBaseID:FBgn0039648 Length:168 Species:Drosophila melanogaster
Sequence 2:XP_003197897.1 Gene:si:ch73-14h1.2 / 100004603 ZFINID:ZDB-GENE-070912-263 Length:326 Species:Danio rerio


Alignment Length:165 Identity:45/165 - (27%)
Similarity:73/165 - (44%) Gaps:12/165 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKDRFKWLSLELLLLIGAAVAFPDGAPADTCVKQRANQPNHGKARSQPAHSNPYEVVADAQTYHP 65
            :|...:::.|..:|.:.|..|:|.|..:..|   .:..|.|....|.....:||.|.:|...|..
Zfish    70 VKMYIQFVLLVFVLNLQAVTAYPHGRVSGVC---SSMVPGHNGTYSSTNLDSPYTVTSDVLYYTD 131

  Fly    66 GQQISVVIYPHSDQSTVFRGFFLQARDANSNEWIGEWVQSENTKTIPEC----SAITHSDNRDKL 126
            ||.|:|.:   ...:|.||||.||||  |..|.:|.:....|:..:..|    ||::|:.:..|.
Zfish   132 GQVITVTL---QGNNTEFRGFLLQAR--NGMEPVGTFTIVGNSSQLLNCGTEGSAVSHNSSTLKS 191

  Fly   127 GAKLIWKAPQNKRGQVYFTGTVLQEYGTFWSDIVN 161
            .....|.||......:.|..|.:|.:..:|..:.:
Zfish   192 TVVAQWNAPNINNTDIQFRATFVQNFSVYWVGVAS 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14515NP_651681.2 Reeler 30..163 CDD:260081 38/136 (28%)
si:ch73-14h1.2XP_003197897.1 Reeler 100..222 CDD:280232 37/129 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 60 1.000 Domainoid score I10552
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5357
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009692
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45828
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.