DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11898 and TAP1

DIOPT Version :9

Sequence 1:NP_651679.2 Gene:CG11898 / 43451 FlyBaseID:FBgn0039645 Length:1320 Species:Drosophila melanogaster
Sequence 2:NP_000584.3 Gene:TAP1 / 6890 HGNCID:43 Length:748 Species:Homo sapiens


Alignment Length:608 Identity:137/608 - (22%)
Similarity:256/608 - (42%) Gaps:116/608 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   717 LILLMFVVARSSEATMDIFLSKWATWEETEPNQHEPIPEYHRTRLRMMILYTFLILCTLIFYVLR 781
            |.|::.|::...|..:..|..:...|...:.:..        |..|.:.|.:.|.:.:.:...:.
Human   189 LFLVLVVLSSLGEMAIPFFTGRLTDWILQDGSAD--------TFTRNLTLMSILTIASAVLEFVG 245

  Fly   782 TFGFFMMTL-RISLRIHDQLFQGVIRAFMHFFTLATSGRILNRFSSDVLAIDVNLPQAMMDSIEF 845
            . |.:..|: .:...:..::|..|:|....||....:|.|::|.:.|...:..:|.:.:...:.:
Human   246 D-GIYNNTMGHVHSHLQGEVFGAVLRQETEFFQQNQTGNIMSRVTEDTSTLSDSLSENLSLFLWY 309

  Fly   846 AVNALAVLAVVSTANIWLLIPATVVVALLY--------GCRCLYIGASRSLKR-----IETISRS 897
            .|..|.:|.::...::.|.:...:.:.||:        ..:.|.:....||.:     ||.:|..
Human   310 LVRGLCLLGIMLWGSVSLTMVTLITLPLLFLLPKKVGKWYQLLEVQVRESLAKSSQVAIEALSAM 374

  Fly   898 P-IYSHTNATFKG------LATIRALNGTKYMERDFHYYQNENTSALYLHVSINRAFAFWTDLIC 955
            | :.|..|...:.      |..|:.||            |.|         ::..|...||..|.
Human   375 PTVRSFANEEGEAQKFREKLQEIKTLN------------QKE---------AVAYAVNSWTTSIS 418

  Fly   956 -------VLYI--LAVT---------FSFLLFDKHRGYYSGDVGLAITQSMKLVLMCQAGMRQTV 1002
                   :|||  ..||         .:|:|:.           :..||:::::|.....:::.|
Human   419 GMLLKVGILYIGGQLVTSGAVSSGNLVTFVLYQ-----------MQFTQAVEVLLSIYPRVQKAV 472

  Fly  1003 ELENMMTSVERVMEYVNIPSEPAYETEESVNLPKHWPSG--------GQLDFRDLRLRYSNH-GP 1058
                  .|.|::.||::             ..|:..|||        |.:.|:|:...|.|. ..
Human   473 ------GSSEKIFEYLD-------------RTPRCPPSGLLTPLHLEGLVQFQDVSFAYPNRPDV 518

  Fly  1059 YILKGLTFTIRGEEKIGIVGHTAAGKSSIVHALFRLAH-INGHISIDGFETSQLGLHDLRRRISI 1122
            .:|:|||||:|..|...:||...:|||::...|..|.. ..|.:.:||....|.....|.|:::.
Human   519 LVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAA 583

  Fly  1123 IPQDPVLFSGSLRFNL--DPFEEKTDEELWLALEAVKLKEFVSNLKDGINCRLHDCGANFSMGQR 1185
            :.|:|.:|..||:.|:  ...::.|.||:..|........|:|.|..|.:..:.:.|:..|.|||
Human   584 VGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQR 648

  Fly  1186 QLVCLARALLRQNKILIMDEATANVDPETDNLIQEAIH---TKFAHCTVLTIAHRLHTVMDNDRV 1247
            |.|.|||||:|:..:||:|:||:.:|..:...:::.::   .:::. :||.|...|..|...|.:
Human   649 QAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSR-SVLLITQHLSLVEQADHI 712

  Fly  1248 MVVDMGRVVELGHPHELLHNRHG 1270
            :.::.|.:.| |..|:.|..:.|
Human   713 LFLEGGAIRE-GGTHQQLMEKKG 734

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11898NP_651679.2 CFTR_protein 9..1268 CDD:273530 136/604 (23%)
ABC_membrane 92..358 CDD:294371
ABCC_MRP_domain1 423..626 CDD:213217
ABC_membrane 762..988 CDD:294371 49/264 (19%)
ABCC_MRP_domain2 1042..1261 CDD:213211 68/225 (30%)
TAP1NP_000584.3 3a01208 18..740 CDD:273363 137/608 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.