DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11898 and Abcb10

DIOPT Version :9

Sequence 1:NP_651679.2 Gene:CG11898 / 43451 FlyBaseID:FBgn0039645 Length:1320 Species:Drosophila melanogaster
Sequence 2:NP_062425.1 Gene:Abcb10 / 56199 MGIID:1860508 Length:715 Species:Mus musculus


Alignment Length:622 Identity:159/622 - (25%)
Similarity:271/622 - (43%) Gaps:92/622 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   704 EYFKVLG--HPLVVVLILLMFVVARSSEATMD--IFLSKWATWEETEPNQHEPIPEYHRTRLRMM 764
            |.:|:||  .|....|...:..:|.||..||.  .||.:......|.|::     .|..:..|:.
Mouse   121 EVWKLLGLVRPERGRLSAAVGFLAVSSVITMSAPFFLGRIIDVIYTNPSE-----GYGDSLTRLC 180

  Fly   765 ILYTFLILC-----TLIFYVLRTFGFFMMTLRISLRIHDQLFQGVIRAFMHFFTLATSGRILNRF 824
            .:.|.:.||     .:..|::::.|..::.     |:...||..::|..:.||....:|.::||.
Mouse   181 AVLTCVFLCGAAANGIRVYLMQSSGQSIVN-----RLRTSLFSSILRQEVAFFDKTRTGELINRL 240

  Fly   825 SSDVLAIDVNLPQAMMDSIEFAVNALAVLAVV-----STANIWL-LIPATVVVALLYGCRCLYIG 883
            |||...:..::.:.:.|.:.....|...:.::     |.|...| ::|...|:|::||       
Mouse   241 SSDTALLGRSVTENLSDGLRAGAQASVGVGMMFFVSPSLATFVLSVVPPISVLAVIYG------- 298

  Fly   884 ASRSLKRIETISRSPIYSHTNATFKGLATIRALNG--------TKYMERDFHYYQNENTSALYLH 940
              |.|:::...::..:...|....:.:..||.:..        .||..|.....|.....||   
Mouse   299 --RYLRKLSKATQDSLAEATQLAEERIGNIRTIRAFGKEMTEVEKYTGRVDQLLQLAQKEAL--- 358

  Fly   941 VSINRAFAFWTDLICVLYILAVTF-----------------SFLLFDKHRGYYSGDVGLAITQSM 988
              ....|.....|...|.:|:|.:                 |||:       |:..|||:|    
Mouse   359 --ARAGFFGAAGLSGNLIVLSVLYKGGLLMGSAHMTVGELSSFLM-------YAFWVGLSI---- 410

  Fly   989 KLVLMCQAGMRQTV-ELENMMTSVERVMEYVNIPSEPAYETEESVNLPKHWPSGGQLDFRDLRLR 1052
                   .|:.... ||...:.:..|:.|.  :..:|.....|.:.|.:. ...|.|:||::...
Mouse   411 -------GGLSSFYSELMKGLGAGGRLWEL--LERQPRLPFNEGMVLDEK-TFQGALEFRNVHFT 465

  Fly  1053 Y-SNHGPYILKGLTFTIRGEEKIGIVGHTAAGKSSIVHALFRLAHIN-GHISIDGFETSQLGLHD 1115
            | :.....:.:..:.:|.......:||.:.:|||::|..|.||...| |.:|:||.:..||....
Mouse   466 YPARPEVSVFQDFSLSIPSGSVTALVGPSGSGKSTVVSLLLRLYDPNSGTVSLDGHDIRQLNPVW 530

  Fly  1116 LRRRISIIPQDPVLFSGSLRFNL----DPFEEKTDEELWLALEAVKLKEFVSNLKDGINCRLHDC 1176
            ||.:|..:.|:|||||.|:..|:    |.....|.:::..|.|.....||:.:...|.:..:.:.
Mouse   531 LRSKIGTVSQEPVLFSCSVAENIAYGADNLSSVTAQQVERAAEVANAAEFIRSFPQGFDTVVGEK 595

  Fly  1177 GANFSMGQRQLVCLARALLRQNKILIMDEATANVDPETDNLIQEAIHTKFAHCTVLTIAHRLHTV 1241
            |...|.||:|.:.:|||||:..|||::||||:.:|.|.::|:|||:.......|||.|||||.|:
Mouse   596 GILLSGGQKQRIAIARALLKNPKILLLDEATSALDAENEHLVQEALDRLMEGRTVLIIAHRLSTI 660

  Fly  1242 MDNDRVMVVDMGRVVELGHPHELLHNRHGYLHRFVEK 1278
            .:.:.|.|:|.|::.|.|...|||...:|...:.:.|
Mouse   661 KNANFVAVLDHGKICEHGTHEELLLKPNGLYRKLMNK 697

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11898NP_651679.2 CFTR_protein 9..1268 CDD:273530 157/610 (26%)
ABC_membrane 92..358 CDD:294371
ABCC_MRP_domain1 423..626 CDD:213217
ABC_membrane 762..988 CDD:294371 52/261 (20%)
ABCC_MRP_domain2 1042..1261 CDD:213211 78/224 (35%)
Abcb10NP_062425.1 3a01208 8..694 CDD:273363 158/617 (26%)
ABC_membrane 142..403 CDD:279056 57/291 (20%)
ABC_MTABC3_MDL1_MDL2 458..698 CDD:213216 81/240 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.