DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11898 and LOC110439293

DIOPT Version :9

Sequence 1:NP_651679.2 Gene:CG11898 / 43451 FlyBaseID:FBgn0039645 Length:1320 Species:Drosophila melanogaster
Sequence 2:XP_021330365.1 Gene:LOC110439293 / 110439293 -ID:- Length:174 Species:Danio rerio


Alignment Length:145 Identity:36/145 - (24%)
Similarity:53/145 - (36%) Gaps:37/145 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 LCSLISGL-----------FFHPFMKYLFRVGSRVRLACAGL--------VYRKFL---RVSVAA 179
            |||| |||           ..||.:...|:....|...|..|        :|.||.   |:|:::
Zfish     4 LCSL-SGLDPLWDWNVTWYTAHPDLTKCFQHTILVWFPCFYLWICAPFYCLYLKFYDNGRISISS 67

  Fly   180 DNSGVSGYAISLMATDLPTFNESFYCFHELWRGPLEGVVFVYIIYQLIGWPAVVGLGTIVAFIPL 244
            .....:|.|:.|.:..   |.|:.|...|..|.....:||:..       |.:..|..|:|.:.:
Zfish    68 LCCAKTGLALCLASFG---FLETVYLLVERRRDIEHHMVFLLS-------PIIRSLTMILAMLMI 122

  Fly   245 QAWAARAIARYKRSS 259
            .....|..    |||
Zfish   123 HLERLRGF----RSS 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11898NP_651679.2 CFTR_protein 9..1268 CDD:273530 36/145 (25%)
ABC_membrane 92..358 CDD:294371 36/145 (25%)
ABCC_MRP_domain1 423..626 CDD:213217
ABC_membrane 762..988 CDD:294371
ABCC_MRP_domain2 1042..1261 CDD:213211
LOC110439293XP_021330365.1 SunT 5..>161 CDD:331423 35/144 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586084
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.