DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdog and YKR104W

DIOPT Version :9

Sequence 1:NP_651678.1 Gene:rdog / 43450 FlyBaseID:FBgn0039644 Length:1374 Species:Drosophila melanogaster
Sequence 2:NP_013030.1 Gene:YKR104W / 853979 SGDID:S000001812 Length:306 Species:Saccharomyces cerevisiae


Alignment Length:293 Identity:128/293 - (43%)
Similarity:174/293 - (59%) Gaps:24/293 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly  1062 MTSVERVLEYTEQPSEALLETPEKFKPKSEWPSKGRIEFINFKLRYSPKEAPVLKDLNFTIEPRE 1126
            |:||||:.|||:.||    |:.....|.:.||..|.:|..|..|||||..:..|.:::|.::...
Yeast     1 MSSVERIKEYTDIPS----ESNGYISPPANWPQTGDVELKNLSLRYSPHSSKALDNVSFKVKAGT 61

  Fly  1127 KIGIVGRTGAGKSSIIQSIFRLA-CNEGMIRIDDVDIEHIGLHDLRSQVSIIPQDPVLFSGTLRY 1190
            |:||||||||||||||.:|:||: ...|.|.||:.||:||.|..||:.:|.|||||.||.||:|.
Yeast    62 KVGIVGRTGAGKSSIIAAIYRLSDWENGTITIDNKDIKHIPLERLRNSISCIPQDPTLFDGTVRS 126

  Fly  1191 NLDPMDERSDEEMWKALGDVELRSYVSTL-------------------IGGLNCRMYDGGSNFSV 1236
            ||||.|..||.:::..|..|.|......|                   ...||..:..||||.|.
Yeast   127 NLDPFDRYSDVQIYGVLSKVGLIEECDELCLIFEQEQPNFSSHKLRNRFIDLNTVVKSGGSNLSQ 191

  Fly  1237 GQRQLVCLARAILRHNKILIMDEATANVDPETDKLIQQTIRSKFAHCTVLTIAHRLHTVMDSDRV 1301
            |||||:||||::|....|:::|||||::|..:|..||:|||....:.|:|||||||.:|:|.|::
Yeast   192 GQRQLLCLARSMLGARNIMLIDEATASIDYISDAKIQKTIRETMKNTTILTIAHRLRSVIDYDKI 256

  Fly  1302 LVMDAGEVRELGHPYELLQRTGGYLRQLVDNTG 1334
            |||:.|.|:|..|||.|:........:|...:|
Yeast   257 LVMEMGRVKEYDHPYTLISDRNTIFYRLCRQSG 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdogNP_651678.1 CFTR_protein 12..1343 CDD:273530 128/293 (44%)
ABC_membrane 94..360 CDD:294371
ABCC_MRP_domain1 448..650 CDD:213217
ABC_membrane 821..1046 CDD:294371
ABCC_MRP_domain2 1096..1315 CDD:213211 108/238 (45%)
YKR104WNP_013030.1 ABCC_NFT1 27..270 CDD:213269 110/242 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344671
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0054
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.