DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD200 and Fas3

DIOPT Version :10

Sequence 1:NP_001004196.2 Gene:CD200 / 4345 HGNCID:7203 Length:294 Species:Homo sapiens
Sequence 2:NP_001097174.1 Gene:Fas3 / 35097 FlyBaseID:FBgn0000636 Length:577 Species:Drosophila melanogaster


Alignment Length:271 Identity:43/271 - (15%)
Similarity:101/271 - (37%) Gaps:68/271 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    57 VQVVTQDEREQLY---TPASLKCSLQNAQEALIVTW-----QKKKAVSPENMVTFSENHGVVIQP 113
            ::::::..||..:   |....:||:::.:....::|     ...|..:|..::: |.|..|.:..
  Fly   128 IELLSRPNREGYFNEGTEFRARCSVRDGRPPANISWYIDNMPANKRTTPLEVMS-STNDNVELST 191

Human   114 AYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYV---------QPI 169
            :.::        :|      |:::.||....:...:.....:.|.......|:         ||.
  Fly   192 SVQE--------IQ------WHLSPEDSNRKLVCRSHHQTDRESVPPQEAAYIINVRYAPVHQPD 242

Human   170 VSLHYKFSEDHLNITCSATARPAPMVFWKVPRS-------------------GIENSTVTLSHPN 215
            .:::..:.|....:..:..|.|.|.:.|.:..:                   |.:...|||:...
  Fly   243 AAVYGLYLEHTAIVNITIRASPQPKIEWTIDGAIVGQGRTDGRYSAYEPQYLGNDEYNVTLAIAG 307

Human   216 GTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNK-----GYWFSVPLLLSIVSLVILL 275
            .|...|:.::.....|::|            :||::..::.     .....|..::.||..|.:|
  Fly   308 LTLEDTTKIYNLRASNELG------------LTDYQVRISSSSKPPSSSLDVAAIVGIVVAVAVL 360

Human   276 VLISILLYWKR 286
            ||:.:|:.:.|
  Fly   361 VLVVLLIVFAR 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD200NP_001004196.2 IgV_1_MRC-OX-2_like 57..164 CDD:409433 16/114 (14%)
FR1 57..77 CDD:409433 3/22 (14%)
Ig strand A 57..61 CDD:409433 0/3 (0%)
Ig strand A' 63..67 CDD:409433 1/3 (33%)
Ig strand B 70..78 CDD:409433 2/7 (29%)
CDR1 78..84 CDD:409433 0/5 (0%)
FR2 85..94 CDD:409433 1/13 (8%)
Ig strand C 86..92 CDD:409433 1/10 (10%)
CDR2 95..112 CDD:409433 4/16 (25%)
Ig strand C' 95..103 CDD:409433 1/7 (14%)
Ig strand C' 108..112 CDD:409433 1/3 (33%)
FR3 118..148 CDD:409433 4/29 (14%)
Ig strand D 118..125 CDD:409433 0/6 (0%)
Ig strand E 128..134 CDD:409433 0/5 (0%)
Ig strand F 142..149 CDD:409433 0/6 (0%)
CDR3 149..155 CDD:409433 0/5 (0%)
Ig strand G 155..164 CDD:409433 1/8 (13%)
FR4 156..164 CDD:409433 1/7 (14%)
Ig <184..255 CDD:472250 14/89 (16%)
Ig strand C 194..198 CDD:409353 0/3 (0%)
Ig strand E 222..226 CDD:409353 0/3 (0%)
Ig strand F 236..241 CDD:409353 0/4 (0%)
Ig strand G 251..254 CDD:409353 0/2 (0%)
Fas3NP_001097174.1 C2-set_2 141..222 CDD:400489 13/95 (14%)
Ig strand B 146..150 CDD:409353 0/3 (0%)
Ig strand C 160..164 CDD:409353 0/3 (0%)
Ig strand E 194..198 CDD:409353 1/17 (6%)
Ig strand F 208..213 CDD:409353 0/4 (0%)
Ig strand G 226..229 CDD:409353 0/2 (0%)
Ig 253..326 CDD:472250 11/72 (15%)

Return to query results.
Submit another query.