DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD200 and Fas3

DIOPT Version :9

Sequence 1:NP_001004196.2 Gene:CD200 / 4345 HGNCID:7203 Length:294 Species:Homo sapiens
Sequence 2:NP_001097174.1 Gene:Fas3 / 35097 FlyBaseID:FBgn0000636 Length:577 Species:Drosophila melanogaster


Alignment Length:271 Identity:43/271 - (15%)
Similarity:101/271 - (37%) Gaps:68/271 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    57 VQVVTQDEREQLY---TPASLKCSLQNAQEALIVTW-----QKKKAVSPENMVTFSENHGVVIQP 113
            ::::::..||..:   |....:||:::.:....::|     ...|..:|..::: |.|..|.:..
  Fly   128 IELLSRPNREGYFNEGTEFRARCSVRDGRPPANISWYIDNMPANKRTTPLEVMS-STNDNVELST 191

Human   114 AYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYV---------QPI 169
            :.::        :|      |:::.||....:...:.....:.|.......|:         ||.
  Fly   192 SVQE--------IQ------WHLSPEDSNRKLVCRSHHQTDRESVPPQEAAYIINVRYAPVHQPD 242

Human   170 VSLHYKFSEDHLNITCSATARPAPMVFWKVPRS-------------------GIENSTVTLSHPN 215
            .:::..:.|....:..:..|.|.|.:.|.:..:                   |.:...|||:...
  Fly   243 AAVYGLYLEHTAIVNITIRASPQPKIEWTIDGAIVGQGRTDGRYSAYEPQYLGNDEYNVTLAIAG 307

Human   216 GTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNK-----GYWFSVPLLLSIVSLVILL 275
            .|...|:.::.....|::|            :||::..::.     .....|..::.||..|.:|
  Fly   308 LTLEDTTKIYNLRASNELG------------LTDYQVRISSSSKPPSSSLDVAAIVGIVVAVAVL 360

Human   276 VLISILLYWKR 286
            ||:.:|:.:.|
  Fly   361 VLVVLLIVFAR 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD200NP_001004196.2 Ig1_MRC-OX-2_like 69..165 CDD:143254 14/103 (14%)
Ig <181..253 CDD:299845 14/90 (16%)
Fas3NP_001097174.1 C2-set_2 141..221 CDD:285423 13/94 (14%)
Ig_TrkABC_d4 235..>333 CDD:143173 17/109 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149340
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28Q44
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.