DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD200 and syg-1

DIOPT Version :9

Sequence 1:NP_001004196.2 Gene:CD200 / 4345 HGNCID:7203 Length:294 Species:Homo sapiens
Sequence 2:NP_001123159.1 Gene:syg-1 / 180555 WormBaseID:WBGene00006365 Length:730 Species:Caenorhabditis elegans


Alignment Length:184 Identity:43/184 - (23%)
Similarity:67/184 - (36%) Gaps:55/184 - (29%)


- Green bases have known domain annotations that are detailed below.


Human   115 YKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTV-YVQPIVSLHY--KF 176
            ||....:.:.|   .|:||..:.:||....:....|...|...|:..|.| :...|:|...  :.
 Worm   307 YKGNQKLRETG---DTLTFETLKMEDHNRDIFCEATNEIGTTRGSIKLNVAFGARIMSTSQDKEV 368

Human   177 SE-DHLNITCSATARPAPMVFW--------------------KVPRSGIENSTVT--------LS 212
            :| |:....|:..|.|||.:||                    :..:.|..|.|.|        ||
 Worm   369 NEGDNAFFHCATLANPAPAIFWTRGDSDEIIGHGENLTLENVRTWQQGNYNCTATVEGFRKQILS 433

Human   213 HPNGTTSVTSILHIKDP-----KNQV------GKEVICQVLHLGTVTDFKQTVN 255
            |         .|||:.|     |::|      ..|:||::.......:.:.|||
 Worm   434 H---------YLHIRGPPTVSMKDEVSASLDEATEIICEISGRPKTNNVRWTVN 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD200NP_001004196.2 Ig1_MRC-OX-2_like 69..165 CDD:143254 13/50 (26%)
Ig <181..253 CDD:299845 23/110 (21%)
syg-1NP_001123159.1 I-set 24..124 CDD:254352
Ig 30..124 CDD:299845
Ig <151..265 CDD:299845
Ig_2 276..353 CDD:290606 12/48 (25%)
IG_like 283..353 CDD:214653 12/48 (25%)
IG_like 363..427 CDD:214653 13/63 (21%)
Ig_2 368..438 CDD:290606 17/78 (22%)
Ig 440..528 CDD:299845 9/39 (23%)
IG_like 450..535 CDD:214653 7/29 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.