DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD200 and Cd200

DIOPT Version :9

Sequence 1:NP_001004196.2 Gene:CD200 / 4345 HGNCID:7203 Length:294 Species:Homo sapiens
Sequence 2:NP_034948.3 Gene:Cd200 / 17470 MGIID:1196990 Length:278 Species:Mus musculus


Alignment Length:263 Identity:204/263 - (77%)
Similarity:232/263 - (88%) Gaps:0/263 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    30 VIRMPFSHLSTYSLVWVMAAVVLCTAQVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKA 94
            |.|.||.|||||||:|.||||.|.||||:|||||||:.|:|.|||:|||:.:||.||||||||||
Mouse     5 VFRRPFCHLSTYSLIWGMAAVALSTAQVEVVTQDERKALHTTASLRCSLKTSQEPLIVTWQKKKA 69

Human    95 VSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGT 159
            ||||||||:|:.|||||||||||:||:|:|||.||:|||||.||||||||||||||||..|:|||
Mouse    70 VSPENMVTYSKTHGVVIQPAYKDRINVTELGLWNSSITFWNTTLEDEGCYMCLFNTFGSQKVSGT 134

Human   160 ACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSIL 224
            ||||:||||||.|||.:.||||||||||||||||.:.||...:||||||.:..|.||||||||||
Mouse   135 ACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGTGIENSTESHFHSNGTTSVTSIL 199

Human   225 HIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKGYWFSVPLLLSIVSLVILLVLISILLYWKRHRN 289
            .:||||.|||||||||||:||.|.|:||:::||:|||||||||||||||||:|||||||||||||
Mouse   200 RVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKGFWFSVPLLLSIVSLVILLILISILLYWKRHRN 264

Human   290 QDR 292
            |:|
Mouse   265 QER 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD200NP_001004196.2 Ig1_MRC-OX-2_like 69..165 CDD:143254 76/95 (80%)
Ig <181..253 CDD:299845 52/71 (73%)
Cd200NP_034948.3 Ig1_MRC-OX-2_like 44..140 CDD:143254 76/95 (80%)
ig 143..229 CDD:278476 62/85 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83954698
Domainoid 1 1.000 157 1.000 Domainoid score I32706
eggNOG 1 0.900 - - E1_28Q44
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4344
Inparanoid 1 1.050 441 1.000 Inparanoid score I13094
Isobase 00.000 Not matched by this tool.
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG37871
OrthoDB 1 1.010 - - D1161268at2759
OrthoFinder 1 1.000 - - FOG0013977
OrthoInspector 1 1.000 - - oto119830
orthoMCL 1 0.900 - - OOG6_111365
Panther 1 1.100 - - LDO PTHR46841
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X7609
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1818.270

Return to query results.
Submit another query.