DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD200 and LOC116408739

DIOPT Version :10

Sequence 1:NP_001004196.2 Gene:CD200 / 4345 HGNCID:7203 Length:294 Species:Homo sapiens
Sequence 2:XP_031752324.1 Gene:LOC116408739 / 116408739 XenbaseID:XB-GENE-29094619 Length:368 Species:Xenopus tropicalis


Alignment Length:283 Identity:79/283 - (27%)
Similarity:129/283 - (45%) Gaps:13/283 - (4%)


- Green bases have known domain annotations that are detailed below.


Human     9 TIGGPLLTATLLGKTTIND---YQVIRMPFSHLSTYSLVWVMAAVVLCTAQVQVVTQDEREQLYT 70
            |:.|...||..:..|..:|   |..|...|:..|...:.::....|| |.:.:.|      :|..
 Frog    95 TVLGLKETAITVWNTQADDEGMYPCIFNIFAVGSVKGITYISFGDVL-TEKSKAV------RLGE 152

Human    71 PASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWN 135
            ..||||.|:...|...||||:......:|:..| ...||.:...|::::..:.|.|..:.|..|.
 Frog   153 SLSLKCVLRKPVEVTQVTWQRTVKDKQDNVAIF-RKEGVEVMDTYRNRLRFSSLDLNVTEIIVWK 216

Human   136 ITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVP 200
            :...|||.|.|||||...|.:||...:.||.....::..|......|:||.||..|.|...|...
 Frog   217 VQAGDEGAYRCLFNTSMSGTLSGETSIYVYEPLNANMEVKSLNGRTNVTCLATGYPQPNTTWNGV 281

Human   201 RSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKGYWFSVPLL 265
            ..|..|.:...:| .|..:|.|.:.:...:::|.:::.|:|.:......||..| |.|..:..::
 Frog   282 GEGNLNGSKLETH-GGIVTVKSWIVVNATESEVREKLECRVQNGEKPRIFKIPV-KSYPQTTIVV 344

Human   266 LSIVSLVILLVLISILLYWKRHR 288
            |.:|.||::|.|:.::...|:.|
 Frog   345 LIVVLLVLVLALVLVICRAKKRR 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD200NP_001004196.2 IgV_1_MRC-OX-2_like 57..164 CDD:409433 33/106 (31%)
FR1 57..77 CDD:409433 5/19 (26%)
Ig strand A 57..61 CDD:409433 0/3 (0%)
Ig strand A' 63..67 CDD:409433 0/3 (0%)
Ig strand B 70..78 CDD:409433 4/7 (57%)
CDR1 78..84 CDD:409433 1/5 (20%)
FR2 85..94 CDD:409433 4/8 (50%)
Ig strand C 86..92 CDD:409433 4/5 (80%)
CDR2 95..112 CDD:409433 4/16 (25%)
Ig strand C' 95..103 CDD:409433 1/7 (14%)
Ig strand C' 108..112 CDD:409433 2/3 (67%)
FR3 118..148 CDD:409433 9/29 (31%)
Ig strand D 118..125 CDD:409433 0/6 (0%)
Ig strand E 128..134 CDD:409433 1/5 (20%)
Ig strand F 142..149 CDD:409433 4/6 (67%)
CDR3 149..155 CDD:409433 2/5 (40%)
Ig strand G 155..164 CDD:409433 2/8 (25%)
FR4 156..164 CDD:409433 2/7 (29%)
Ig <184..255 CDD:472250 18/70 (26%)
Ig strand C 194..198 CDD:409353 0/3 (0%)
Ig strand E 222..226 CDD:409353 1/3 (33%)
Ig strand F 236..241 CDD:409353 1/4 (25%)
Ig strand G 251..254 CDD:409353 1/2 (50%)
LOC116408739XP_031752324.1 Ig 31..131 CDD:472250 10/35 (29%)
Ig strand B 45..49 CDD:409353
Ig strand C 59..63 CDD:409353
Ig strand E 102..106 CDD:409353 2/3 (67%)
Ig strand F 116..121 CDD:409353 1/4 (25%)
Ig 140..241 CDD:472250 36/108 (33%)
Ig strand B 154..158 CDD:409353 2/3 (67%)
Ig strand C 168..172 CDD:409353 2/3 (67%)
Ig strand E 210..214 CDD:409353 1/3 (33%)
Ig strand F 224..229 CDD:409353 2/4 (50%)
Ig strand G 238..241 CDD:409353 2/2 (100%)
Ig <264..324 CDD:472250 16/60 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.