DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Slbp and SLBP

DIOPT Version :9

Sequence 1:NP_477480.1 Gene:Slbp / 43448 FlyBaseID:FBgn0041186 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_006518.1 Gene:SLBP / 7884 HGNCID:10904 Length:270 Species:Homo sapiens


Alignment Length:228 Identity:69/228 - (30%)
Similarity:102/228 - (44%) Gaps:51/228 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 HSDEASSSLNSSAASCGSLAKKETADG------NLESKDGEGREMAFEFLDGVNEVKFERLVKEE 107
            |........:..:.:..||.:|..|||      :.|..:..|.|                     
Human    11 HQSRCDGDASPPSPARWSLGRKRRADGRRWRPEDAEEAEHRGAE--------------------- 54

  Fly   108 KLKTPYKRRHSFTPPSNENSRSNSPNSSNSSANGDAAAPKGGNNPHSRNSKKSGNFRAH---KEE 169
                  :|..|||.|.....||..         .|.|:....:...:|.:|:...::..   .:.
Human    55 ------RRPESFTTPEGPKPRSRC---------SDWASAVEEDEMRTRVNKEMARYKRKLLINDF 104

  Fly   170 KRVRHNSYTSSTSSSSSYT-----EADPAILSRRQKQIDYGKNTAAYERYVEMVPKDERTRD-HP 228
            .|.|.:|..||.|..|..|     |.|.::|.||||||:|||||.||:||::.||:..|... ||
Human   105 GRERKSSSGSSDSKESMSTVPADFETDESVLMRRQKQINYGKNTIAYDRYIKEVPRHLRQPGIHP 169

  Fly   229 RTPNKYGKYSRRAFDGLVKIWRKSLHIYDPPTQ 261
            :||||:.|||||::|..:|:|:.:||.:|||.:
Human   170 KTPNKFKKYSRRSWDQQIKLWKVALHFWDPPAE 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SlbpNP_477480.1 SLBP_RNA_bind 191..256 CDD:291900 36/65 (55%)
SLBPNP_006518.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..132 30/156 (19%)
Nuclear localization signal NLS1 31..34 1/2 (50%)
Nuclear localization signal NLS2 96..99 0/2 (0%)
RNA-binding 129..198 37/68 (54%)
SLBP_RNA_bind 130..198 CDD:405844 36/67 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 215..241
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157024
Domainoid 1 1.000 87 1.000 Domainoid score I8019
eggNOG 1 0.900 - - E1_KOG3934
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I5013
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003353
OrthoInspector 1 1.000 - - oto90698
orthoMCL 1 0.900 - - OOG6_103940
Panther 1 1.100 - - O PTHR17408
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2795
SonicParanoid 1 1.000 - - X2243
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.870

Return to query results.
Submit another query.