DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Slbp and slbp2

DIOPT Version :9

Sequence 1:NP_477480.1 Gene:Slbp / 43448 FlyBaseID:FBgn0041186 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001073645.1 Gene:slbp2 / 558918 ZFINID:ZDB-GENE-070112-1722 Length:326 Species:Danio rerio


Alignment Length:157 Identity:59/157 - (37%)
Similarity:80/157 - (50%) Gaps:30/157 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 SRSNSPNSSNSSANGDAAAPKGGNNPHS---------RNSKKS---------GNFRAHKEEKRVR 173
            |.|.:|.|  :|.||:  .|.....|..         |.|..|         |..|:....|...
Zfish    60 SCSKTPLS--ASQNGE--KPSAVQKPRRSSILERCILRMSTASVAVGTEDLDGVKRSPSRGKWYP 120

  Fly   174 HNSYTSSTSSSSSYTEADPAILSRRQKQIDYGKNTAAYERYVEMVPKDERTRD-HPRTPNKYGKY 237
            ||       :..|:.|.:.|:|.||||||.|||||..|:.||:.|||..|... ||.|||||.||
Zfish   121 HN-------ADPSHFEINEAVLKRRQKQIQYGKNTCGYQNYVQQVPKRLRVPGIHPSTPNKYRKY 178

  Fly   238 SRRAFDGLVKIWRKSLHIYDPPTQARD 264
            |||::|..|::||::||.:|.|:.:::
Zfish   179 SRRSWDMQVRLWRRALHAWDLPSASQN 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SlbpNP_477480.1 SLBP_RNA_bind 191..256 CDD:291900 38/65 (58%)
slbp2NP_001073645.1 SLBP_RNA_bind 132..197 CDD:291900 38/64 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592689
Domainoid 1 1.000 87 1.000 Domainoid score I7970
eggNOG 1 0.900 - - E1_KOG3934
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003353
OrthoInspector 1 1.000 - - otm26390
orthoMCL 1 0.900 - - OOG6_103940
Panther 1 1.100 - - LDO PTHR17408
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2795
SonicParanoid 1 1.000 - - X2243
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.820

Return to query results.
Submit another query.