DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Slbp and Slbp

DIOPT Version :9

Sequence 1:NP_477480.1 Gene:Slbp / 43448 FlyBaseID:FBgn0041186 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_033219.1 Gene:Slbp / 20492 MGIID:108402 Length:275 Species:Mus musculus


Alignment Length:225 Identity:74/225 - (32%)
Similarity:109/225 - (48%) Gaps:43/225 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 FGHSDEASSSLNSSAASCGSLAKKETADG-NLESKDGEGREMAFEFLDGVNEVKFERLVKEEKLK 110
            :|...:..:|..|.|.  .||.:|..||| :.:.:|.|                      |.:|:
Mouse    11 YGSRRDGGASPRSPAR--WSLGRKRRADGRDRKPEDSE----------------------EGELQ 51

  Fly   111 TPYKRRHSFTPPSNENSRSNSPNSSNSSANGDAAAPKGGNNPHSRNSKKSGNFRAH---KEEKRV 172
            |...|..|||.|.....||..         .|.|:....:...:|.:|:...::..   .:..|.
Mouse    52 TADHRPESFTTPEGHKPRSRC---------SDWASAVEEDEMRTRVNKEIARYKRKLLINDFGRE 107

  Fly   173 RHNSYTSSTSSSS-----SYTEADPAILSRRQKQIDYGKNTAAYERYVEMVPKDERTRD-HPRTP 231
            |.:|..||.|..|     :..|.|.::|.||||||:|||||.||:||::.||:..|... |||||
Mouse   108 RKSSSGSSDSKESMSSVPADVETDESVLMRRQKQINYGKNTIAYDRYIKEVPRHLRQPGIHPRTP 172

  Fly   232 NKYGKYSRRAFDGLVKIWRKSLHIYDPPTQ 261
            ||:.|||||::|..:|:|:.:||.:|||.:
Mouse   173 NKFKKYSRRSWDQQIKLWKVALHFWDPPAE 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SlbpNP_477480.1 SLBP_RNA_bind 191..256 CDD:291900 37/65 (57%)
SlbpNP_033219.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..88 20/77 (26%)
Nuclear localization signal NLS1. /evidence=ECO:0000250 31..34 1/2 (50%)
Nuclear localization signal NLS2. /evidence=ECO:0000250 96..99 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 103..133 4/32 (13%)
RNA-binding. /evidence=ECO:0000250 129..198 34/77 (44%)
SLBP_RNA_bind 130..197 CDD:373680 33/75 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..240 3/7 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847427
Domainoid 1 1.000 89 1.000 Domainoid score I7859
eggNOG 1 0.900 - - E1_KOG3934
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 102 1.000 Inparanoid score I4953
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003353
OrthoInspector 1 1.000 - - oto94285
orthoMCL 1 0.900 - - OOG6_103940
Panther 1 1.100 - - O PTHR17408
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2795
SonicParanoid 1 1.000 - - X2243
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.870

Return to query results.
Submit another query.