DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Slbp and XB5920187

DIOPT Version :9

Sequence 1:NP_477480.1 Gene:Slbp / 43448 FlyBaseID:FBgn0041186 Length:276 Species:Drosophila melanogaster
Sequence 2:XP_004912937.2 Gene:XB5920187 / 100487104 XenbaseID:XB-GENE-5920188 Length:280 Species:Xenopus tropicalis


Alignment Length:93 Identity:50/93 - (53%)
Similarity:66/93 - (70%) Gaps:5/93 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 HNSYTSSTSSSSSYT----EADPAILSRRQKQIDYGKNTAAYERYVEMVPKDERTRD-HPRTPNK 233
            |:.::.|.|.:.|:.    |.|.|.|.||||||||||||..|:.|::.|||.||... |||||||
 Frog   113 HSDFSFSRSMTISHDTARYETDEATLQRRQKQIDYGKNTIGYQCYLQQVPKSERKPGVHPRTPNK 177

  Fly   234 YGKYSRRAFDGLVKIWRKSLHIYDPPTQ 261
            |.|||||::|..:|:||::||.:|||:|
 Frog   178 YKKYSRRSWDMQIKLWRRALHAWDPPSQ 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SlbpNP_477480.1 SLBP_RNA_bind 191..256 CDD:291900 41/65 (63%)
XB5920187XP_004912937.2 SLBP_RNA_bind 133..201 CDD:405844 41/67 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7359
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003353
OrthoInspector 1 1.000 - - otm48953
Panther 1 1.100 - - LDO PTHR17408
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2243
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.100

Return to query results.
Submit another query.