DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Slbp and LOC100363294

DIOPT Version :9

Sequence 1:NP_477480.1 Gene:Slbp / 43448 FlyBaseID:FBgn0041186 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001257345.2 Gene:LOC100363294 / 100363294 RGDID:2323347 Length:169 Species:Rattus norvegicus


Alignment Length:74 Identity:37/74 - (50%)
Similarity:54/74 - (72%) Gaps:1/74 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 EADPAILSRRQKQIDYGKNTAAYERYVEMVPKDERTRD-HPRTPNKYGKYSRRAFDGLVKIWRKS 252
            |.|..:|.||||||||||.|..|:.:::.||:.:|... ||:||||..:||||::|..::.||::
  Rat    26 ETDEVVLRRRQKQIDYGKCTPGYQSFLQQVPRAQRQPGFHPQTPNKNRRYSRRSWDAQIRQWRRA 90

  Fly   253 LHIYDPPTQ 261
            ||.:|||:|
  Rat    91 LHTWDPPSQ 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SlbpNP_477480.1 SLBP_RNA_bind 191..256 CDD:291900 32/65 (49%)
LOC100363294NP_001257345.2 SLBP_RNA_bind 27..95 CDD:405844 32/67 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350980
Domainoid 1 1.000 89 1.000 Domainoid score I7669
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003353
OrthoInspector 1 1.000 - - otm45863
orthoMCL 1 0.900 - - OOG6_103940
Panther 1 1.100 - - LDO PTHR17408
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2243
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.840

Return to query results.
Submit another query.