DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pglym78 and YOR283W

DIOPT Version :9

Sequence 1:NP_001034075.1 Gene:Pglym78 / 43447 FlyBaseID:FBgn0014869 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_014926.1 Gene:YOR283W / 854457 SGDID:S000005809 Length:230 Species:Saccharomyces cerevisiae


Alignment Length:246 Identity:63/246 - (25%)
Similarity:104/246 - (42%) Gaps:50/246 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KIVMVRHGESEWNQKNQFCGWYDANLSEKGQEEALAAGKAVKDAGLEFDVAHTSVLTRAQVTLAS 70
            ::.::|||::|.|.|....|..|.:::..|:|:|...|..::..|:.||...:|.|.|.:.|.|.
Yeast    18 RLFIIRHGQTEHNVKKILQGHKDTSINPTGEEQATKLGHYLRSRGIHFDKVVSSDLKRCRQTTAL 82

  Fly    71 ILKASGHKEIPIQKTWRLNERHYGGLTGLNKAET---AAKYGEAQVQIWRRSFDTPPPPMEPGHP 132
            :||.|..:.:|...|..|.||:.|.:.|:...|.   |.|:||...    |:|            
Yeast    83 VLKHSKQENVPTSYTSGLRERYMGVIEGMQITEAEKYADKHGEGSF----RNF------------ 131

  Fly   133 YYENIVKDPRYAEGPKPEEFPQFESLKLTIERTLPYWNDVIIPQMKEG-KRILIAAHGNSLRGIV 196
                         |.|.::|         :.|......:.:.....|| |.:.:.:||.::|.|:
Yeast   132 -------------GEKSDDF---------VARLTGCVEEEVAEASNEGVKNLALVSHGGAIRMIL 174

  Fly   197 KHL--DNLSEDAIMALNLPTGIPFV-YELDEN---FKPVVSMQFLGDEETV 241
            :.|  :|.....|:..|  |.:..| |..|..   .:.|.:.|.|||.|.|
Yeast   175 QWLKYENHQAHKIIVFN--TSVTIVDYVKDSKQFIVRRVGNTQHLGDGEFV 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pglym78NP_001034075.1 HP 5..255 CDD:299704 63/246 (26%)
YOR283WNP_014926.1 His_Phos_1 19..214 CDD:395236 57/234 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0588
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.