DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pglym78 and GPM3

DIOPT Version :9

Sequence 1:NP_001034075.1 Gene:Pglym78 / 43447 FlyBaseID:FBgn0014869 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_014585.1 Gene:GPM3 / 854098 SGDID:S000005417 Length:303 Species:Saccharomyces cerevisiae


Alignment Length:308 Identity:92/308 - (29%)
Similarity:149/308 - (48%) Gaps:70/308 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YKIVMVRHGESEWNQKNQFCGWYDANLSEKGQEEALAAGKAVKDAGLEF---------DVAHTSV 60
            :|:.::|||:||.|.:|.||||.||.|:|||:.:|..:.|.:|    :|         .:.:||.
Yeast     7 FKLFILRHGQSELNSENIFCGWIDAQLTEKGKSQARHSAKLIK----QFCDSNNISLPQIGYTSR 67

  Fly    61 LTRAQVTLASILKASGHK-----------------------EIPIQKTWRLNERHYGGLTGLNKA 102
            |.|.|.|:..||:..|.|                       .:|:.:||||||||||...|..|.
Yeast    68 LIRTQQTMDVILEELGLKHTNYVITTNTNIKEELQDTRFEGSMPVLQTWRLNERHYGAWQGQRKP 132

  Fly   103 ETAAKYGEAQVQIWRRSFDTPPPPM---------------EPGHPYYENIVKDP----RYAEGPK 148
            :...:||:.:....||.::..||.:               ..|:.:     |:|    :|  ||:
Yeast   133 DILKEYGKEKYMYIRRDYNGKPPKVNLNLEMVQEENDQGSSTGYDF-----KEPNRHLKY--GPE 190

  Fly   149 P---EEFPQFESLKLTIERTLPYWNDVIIPQMKE--GKRILIAAHGNSLRGIVKHLDNLSEDAIM 208
            .   |..|:.|||...:.|..|:.|:|::....:  .:..:|..||:|:|.::|.|:.:|::.|.
Yeast   191 EKANERLPESESLCEVVVRLKPFLNNVVLSTANKISQESCVIVGHGSSVRSLLKVLEGISDEDIK 255

  Fly   209 ALNLPTGIPFVYELD-ENFKPVVSMQFLGDEETVKKAIEAVAAQGKAK 255
            .:::|.|||.|.||| :|:..|  .:|..|.|:.|...:.|..:|..|
Yeast   256 DVDIPNGIPLVIELDRDNYSFV--RKFYLDPESAKVNAQMVRDEGFEK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pglym78NP_001034075.1 HP 5..255 CDD:299704 91/306 (30%)
GPM3NP_014585.1 GpmA 6..284 CDD:223661 86/289 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346327
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0588
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S620
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.650

Return to query results.
Submit another query.