DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pglym78 and AT1G22170

DIOPT Version :9

Sequence 1:NP_001034075.1 Gene:Pglym78 / 43447 FlyBaseID:FBgn0014869 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001321168.1 Gene:AT1G22170 / 838822 AraportID:AT1G22170 Length:334 Species:Arabidopsis thaliana


Alignment Length:245 Identity:95/245 - (38%)
Similarity:129/245 - (52%) Gaps:57/245 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IVMVRHGESEWNQKNQFCGWYDANLSEKGQEEALAAGKAVKDAGLEFDVAHTSVLTRAQVTLASI 71
            ::::|||||.||:||.|.|..|..|:|||.|||:.|||.:  :.:..||..||.|.|||:|....
plant    80 LILIRHGESLWNEKNLFTGCVDVPLTEKGVEEAIEAGKRI--SNIPVDVIFTSSLIRAQMTAMLA 142

  Fly    72 LKASGHKEIPI--------QKT-------------------WRLNERHYGGLTGLNKAETAAKYG 109
            :.....|::||        .||                   |:||||.||.|.||||.|||.:||
plant   143 MIQHRRKKVPIILHDESEQAKTWSQVFSDETKNQSIPVIPAWQLNERMYGELQGLNKQETAERYG 207

  Fly   110 EAQVQIWRRSFDTPPPPMEPGHPYYENIVKDPRYAEGPKPEEFPQFESLKLTIERTLPYWNDVII 174
            :.||..||||:|.||                            |:.|||::..||.:.|:.|.|.
plant   208 KEQVHEWRRSYDIPP----------------------------PKGESLEMCAERAVAYFQDNIE 244

  Fly   175 PQMKEGKRILIAAHGNSLRGIVKHLDNLSEDAIMALNLPTGIPFVYELDE 224
            |::..||.::|||||||||.|:.:||.|:...:::|.|.||||.:|...|
plant   245 PKLAAGKNVMIAAHGNSLRSIIMYLDKLTCQEVISLELSTGIPLLYIFKE 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pglym78NP_001034075.1 HP 5..255 CDD:299704 95/245 (39%)
AT1G22170NP_001321168.1 HP 78..305 CDD:416258 95/245 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 104 1.000 Domainoid score I2230
eggNOG 1 0.900 - - E1_COG0588
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37647
Inparanoid 1 1.050 163 1.000 Inparanoid score I1611
OMA 1 1.010 - - QHG61896
OrthoDB 1 1.010 - - D804949at2759
OrthoFinder 1 1.000 - - FOG0000615
OrthoInspector 1 1.000 - - mtm1064
orthoMCL 1 0.900 - - OOG6_101500
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X392
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.740

Return to query results.
Submit another query.