DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pglym78 and F2KP

DIOPT Version :9

Sequence 1:NP_001034075.1 Gene:Pglym78 / 43447 FlyBaseID:FBgn0014869 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_172191.1 Gene:F2KP / 837221 AraportID:AT1G07110 Length:744 Species:Arabidopsis thaliana


Alignment Length:219 Identity:53/219 - (24%)
Similarity:88/219 - (40%) Gaps:62/219 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IVMVRHGESEWNQKNQFCGWYDANLSEKGQ----------EEALAAGKAVKDAGLEFDVAHTSVL 61
            |::.|||||..|.:.:..|  |:.:|:.|:          |:.|.:.||..        ..||.|
plant   553 ILLTRHGESMDNVRGRIGG--DSVISDSGKLYAKKLASFVEKRLKSEKAAS--------IWTSTL 607

  Fly    62 TRAQVTLASILKASGHKEIPIQKTWR-LNERHYGGLTGLNKAETAAKYGEAQVQIWRRSFDTPPP 125
            .|..:|.:||:   |..::    .|| |:|.:.|...|:.       |.|.:..:          
plant   608 QRTNLTASSIV---GFPKV----QWRALDEINAGVCDGMT-------YEEVKKNM---------- 648

  Fly   126 PMEPGHPYYENIVKDP-RYAEGPKPEEFPQFESLKLTIERTLPYWNDVIIPQMKEGKRILIAAHG 189
            |.|     ||:..||. ||       .:|:.||....|:|..|    |||...::...:::.:|.
plant   649 PEE-----YESRKKDKLRY-------RYPRGESYLDVIQRLEP----VIIELERQRAPVVVISHQ 697

  Fly   190 NSLRGIVKHLDNLSEDAIMALNLP 213
            ..||.:..:..:.....|..:.:|
plant   698 AVLRALYAYFADRPLKEIPQIEMP 721

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pglym78NP_001034075.1 HP 5..255 CDD:299704 53/219 (24%)
F2KPNP_172191.1 CBM_2 25..110 CDD:215006
6PF2K 332..550 CDD:396253
His_Phos_1 553..728 CDD:395236 53/219 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.