DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pglym78 and BPGM

DIOPT Version :9

Sequence 1:NP_001034075.1 Gene:Pglym78 / 43447 FlyBaseID:FBgn0014869 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001280014.1 Gene:BPGM / 669 HGNCID:1093 Length:259 Species:Homo sapiens


Alignment Length:253 Identity:125/253 - (49%)
Similarity:174/253 - (68%) Gaps:1/253 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KYKIVMVRHGESEWNQKNQFCGWYDANLSEKGQEEALAAGKAVKDAGLEFDVAHTSVLTRAQVTL 68
            |||::|:||||..||::|:||.|.|..|:.:|.|||...||.:|....|||:..||||.|:..|.
Human     3 KYKLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVLNRSIHTA 67

  Fly    69 ASILKASGHKEIPIQKTWRLNERHYGGLTGLNKAETAAKYGEAQVQIWRRSFDTPPPPMEPGHPY 133
            ..||:..|.:.:|::.:|||||||||.|.|||:.:.|..:||.||::||||::..|||:|..|||
Human    68 WLILEELGQEWVPVESSWRLNERHYGALIGLNREQMALNHGEEQVRLWRRSYNVTPPPIEESHPY 132

  Fly   134 YENIVKDPRYAEGPKP-EEFPQFESLKLTIERTLPYWNDVIIPQMKEGKRILIAAHGNSLRGIVK 197
            |:.|..|.||.....| ::.|:.||||..:||.|||||:.|.|::..||.|||:|||||.|.::|
Human   133 YQEIYNDRRYKVCDVPLDQLPRSESLKDVLERLLPYWNERIAPEVLRGKTILISAHGNSSRALLK 197

  Fly   198 HLDNLSEDAIMALNLPTGIPFVYELDENFKPVVSMQFLGDEETVKKAIEAVAAQGKAK 255
            ||:.:|::.|:.:.||||:|.:.|||||.:.|...|||||:|.::.||:.|..|||.|
Human   198 HLEGISDEDIINITLPTGVPILLELDENLRAVGPHQFLGDQEAIQAAIKKVEDQGKVK 255

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Pglym78NP_001034075.1 HP 5..255 CDD:299704 123/250 (49%)
BPGMNP_001280014.1 HP 4..255 CDD:325018 123/250 (49%)
Substrate binding. /evidence=ECO:0000269|PubMed:17052986 10..17 4/6 (67%)