DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pglym78 and tigara

DIOPT Version :9

Sequence 1:NP_001034075.1 Gene:Pglym78 / 43447 FlyBaseID:FBgn0014869 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001034925.1 Gene:tigara / 664696 ZFINID:ZDB-GENE-060312-25 Length:256 Species:Danio rerio


Alignment Length:221 Identity:48/221 - (21%)
Similarity:79/221 - (35%) Gaps:74/221 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YKIVMVRHGESEWNQKNQFCGW-YDANLSEKGQEEALAAGKAVKDAGLEFDVAHTSVLTRAQVTL 68
            :.:.:|||||::.|:.....|. .|:.||:.|.:::.|||:.::|  ::|.....|.:.||:.|.
Zfish     4 FGLTVVRHGETQCNKDGLLQGQKIDSLLSDIGIQQSEAAGQYLRD--VKFTNVFVSNMKRAKQTA 66

  Fly    69 ASILK--ASGHKEIPIQKTWRLNERHYGGLTG------LNKAETAAK--------YGEAQVQIWR 117
            ..|::  .:.| ::.:.....|.||.:|...|      .|.|:.|.:        .||...|:..
Zfish    67 EIIVRNNRTCH-DLELVADPSLIERSFGIAEGGRVIDMKNMAKAAGQPLPEFTPPEGETMEQVKL 130

  Fly   118 RSFD------------------------------------------TPPPPMEPGHPYYENIVKD 140
            |..|                                          .|...:..||..|.:|.. 
Zfish   131 RIKDFLKAMYQRIANDHQDKVQDGGTSSADESTEAPAGLANDGVSSVPVHALVVGHGAYMSIAM- 194

  Fly   141 PRYAEGPKPEEFPQFESLKLTIERTL 166
             ||.          ||.||..:.|.|
Zfish   195 -RYF----------FEDLKCPVPRGL 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pglym78NP_001034075.1 HP 5..255 CDD:299704 48/221 (22%)
tigaraNP_001034925.1 His_Phos_1 6..229 CDD:278716 48/219 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 147..170 0/22 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0588
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.