DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pglym78 and pgam2

DIOPT Version :9

Sequence 1:NP_001034075.1 Gene:Pglym78 / 43447 FlyBaseID:FBgn0014869 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_957318.1 Gene:pgam2 / 572733 ZFINID:ZDB-GENE-040116-6 Length:255 Species:Danio rerio


Alignment Length:255 Identity:165/255 - (64%)
Similarity:208/255 - (81%) Gaps:1/255 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGGKYKIVMVRHGESEWNQKNQFCGWYDANLSEKGQEEALAAGKAVKDAGLEFDVAHTSVLTRAQ 65
            |...:::|:||||||.|||:|:||||:||:|||||.|||....:|:||||::|||.:||||.||.
Zfish     1 MAAAHRLVIVRHGESSWNQENRFCGWFDADLSEKGLEEAKRGAQAIKDAGMKFDVCYTSVLKRAI 65

  Fly    66 VTLASILKASGHKEIPIQKTWRLNERHYGGLTGLNKAETAAKYGEAQVQIWRRSFDTPPPPMEPG 130
            .||.:|::.:....:|:.:|||||||||||||||||||||||:||.||:|||||||.|||||:..
Zfish    66 KTLWTIMEGTDQMWVPVVRTWRLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFDIPPPPMDKD 130

  Fly   131 HPYYENIVKDPRYAEGPKPEEFPQFESLKLTIERTLPYWNDVIIPQMKEGKRILIAAHGNSLRGI 195
            |||::.|.:..|| :|.|..|.|..||||.||.|.||:||:||:|::|.||.::|||||||||||
Zfish   131 HPYHKIISESRRY-KGLKEGELPICESLKDTIARALPFWNEVIVPEIKAGKNVIIAAHGNSLRGI 194

  Fly   196 VKHLDNLSEDAIMALNLPTGIPFVYELDENFKPVVSMQFLGDEETVKKAIEAVAAQGKAK 255
            ||||:::|:.|||.||||||||.|||||::.||:..||||||||||:||:||||||||.|
Zfish   195 VKHLESMSDAAIMELNLPTGIPIVYELDKDLKPIKPMQFLGDEETVRKAMEAVAAQGKVK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pglym78NP_001034075.1 HP 5..255 CDD:299704 163/249 (65%)
pgam2NP_957318.1 gpmA 5..254 CDD:184516 163/249 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595443
Domainoid 1 1.000 183 1.000 Domainoid score I3361
eggNOG 1 0.900 - - E1_COG0588
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 354 1.000 Inparanoid score I2211
OMA 1 1.010 - - QHG61896
OrthoDB 1 1.010 - - D496634at33208
OrthoFinder 1 1.000 - - FOG0000615
OrthoInspector 1 1.000 - - mtm6585
orthoMCL 1 0.900 - - OOG6_101500
Panther 1 1.100 - - O PTHR11931
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R933
SonicParanoid 1 1.000 - - X392
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.