DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pglym78 and bpgm

DIOPT Version :9

Sequence 1:NP_001034075.1 Gene:Pglym78 / 43447 FlyBaseID:FBgn0014869 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001016599.1 Gene:bpgm / 549353 XenbaseID:XB-GENE-981498 Length:259 Species:Xenopus tropicalis


Alignment Length:254 Identity:133/254 - (52%)
Similarity:178/254 - (70%) Gaps:3/254 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KYKIVMVRHGESEWNQKNQFCGWYDANLSEKGQEEALAAGKAVKDAGLEFDVAHTSVLTRAQVTL 68
            |||:||:||||..||.:|:||.|.|..||..|..||...||.:|..|.|||:..||:|:|:..|.
 Frog     3 KYKLVMLRHGEGAWNIENRFCSWVDQKLSADGLREAEECGKKLKSLGFEFDLVFTSILSRSIQTA 67

  Fly    69 ASILKASGHKEIPIQKTWRLNERHYGGLTGLNKAETAAKYGEAQVQIWRRSFDTPPPPMEPGHPY 133
            ..:|:....:.:|||.:|||||||||.|.|||:||.|..:||.||:|||||:|..|||::..|||
 Frog    68 WLVLRELDQEWVPIQSSWRLNERHYGALIGLNRAELALNHGEEQVKIWRRSYDVSPPPIDASHPY 132

  Fly   134 YENIVKDPRY--AEGPKPEEFPQFESLKLTIERTLPYWNDVIIPQMKEGKRILIAAHGNSLRGIV 196
            |:.|..|.||  .:.|| |:.|:.||||..:||.|||||:||.|::|.|||:||:|||||.|.::
 Frog   133 YQEIHTDRRYTTCDIPK-EKLPKSESLKQVLERLLPYWNEVIAPEIKNGKRVLISAHGNSTRALL 196

  Fly   197 KHLDNLSEDAIMALNLPTGIPFVYELDENFKPVVSMQFLGDEETVKKAIEAVAAQGKAK 255
            |||:.:|:..|:.::||||:|.:.|||||..||...:||||:|.::.||:.|..|||.|
 Frog   197 KHLEGISDSDIVNISLPTGVPVLLELDENLHPVKPHEFLGDQEAIRAAIKKVEDQGKVK 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pglym78NP_001034075.1 HP 5..255 CDD:299704 131/251 (52%)
bpgmNP_001016599.1 HP 5..253 CDD:386100 128/248 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG61896
OrthoDB 1 1.010 - - D496634at33208
OrthoFinder 1 1.000 - - FOG0000615
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11931
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X392
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.