DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pglym78 and pgam2

DIOPT Version :9

Sequence 1:NP_001034075.1 Gene:Pglym78 / 43447 FlyBaseID:FBgn0014869 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001005665.1 Gene:pgam2 / 448157 XenbaseID:XB-GENE-971122 Length:253 Species:Xenopus tropicalis


Alignment Length:251 Identity:164/251 - (65%)
Similarity:198/251 - (78%) Gaps:1/251 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YKIVMVRHGESEWNQKNQFCGWYDANLSEKGQEEALAAGKAVKDAGLEFDVAHTSVLTRAQVTLA 69
            :::|:||||||.|||:|:||||:||:|||||.|||....:|:|:||:|||:.:||||.||..||.
 Frog     3 HRLVIVRHGESSWNQENRFCGWFDADLSEKGAEEARRGAQAIKEAGMEFDICYTSVLKRAVRTLW 67

  Fly    70 SILKASGHKEIPIQKTWRLNERHYGGLTGLNKAETAAKYGEAQVQIWRRSFDTPPPPMEPGHPYY 134
            .||.......:|:.:|||||||||||||||||||||.|:||.||:|||||||.|||.|...|.||
 Frog    68 YILDGIDQMWLPVVRTWRLNERHYGGLTGLNKAETAEKHGEEQVKIWRRSFDIPPPVMGEDHSYY 132

  Fly   135 ENIVKDPRYAEGPKPEEFPQFESLKLTIERTLPYWNDVIIPQMKEGKRILIAAHGNSLRGIVKHL 199
            :.|.||.||.:..: :|.|..||||.||.|.||:||:||.||:..|||::|||||||||||||||
 Frog   133 KLISKDRRYKDLTQ-KELPSCESLKDTIARALPFWNEVIAPQILAGKRVMIAAHGNSLRGIVKHL 196

  Fly   200 DNLSEDAIMALNLPTGIPFVYELDENFKPVVSMQFLGDEETVKKAIEAVAAQGKAK 255
            |.:|:.|||.||||||||.|||||:|.||:..|.||||||||:||:||||||||.|
 Frog   197 DGMSDAAIMELNLPTGIPIVYELDDNLKPIKPMSFLGDEETVRKAMEAVAAQGKVK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pglym78NP_001034075.1 HP 5..255 CDD:299704 163/249 (65%)
pgam2NP_001005665.1 gpmA 3..252 CDD:184516 163/249 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 176 1.000 Domainoid score I3548
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 354 1.000 Inparanoid score I2197
OMA 1 1.010 - - QHG61896
OrthoDB 1 1.010 - - D496634at33208
OrthoFinder 1 1.000 - - FOG0000615
OrthoInspector 1 1.000 - - mtm9531
Panther 1 1.100 - - O PTHR11931
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R933
SonicParanoid 1 1.000 - - X392
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.