DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pglym78 and tigarb

DIOPT Version :9

Sequence 1:NP_001034075.1 Gene:Pglym78 / 43447 FlyBaseID:FBgn0014869 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_956485.1 Gene:tigarb / 393160 ZFINID:ZDB-GENE-040426-885 Length:257 Species:Danio rerio


Alignment Length:275 Identity:71/275 - (25%)
Similarity:111/275 - (40%) Gaps:64/275 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YKIVMVRHGESEWNQKNQFCG-WYDANLSEKGQEEALAAGKAVKDAGLEFDVAHTSVLTR----A 64
            :.:.:|||||:::|:.....| ..|..||:.|.::|.|||:.:||  |.|.....|.|.|    |
Zfish     4 FALTIVRHGETQYNRDKLLQGQGIDTPLSDTGHQQAAAAGRYLKD--LHFTNVFVSNLQRAIQTA 66

  Fly    65 QVTLASILKASGHKEI--PIQKTWRLNERHYGGLTGLNKAETAAKYGEAQVQIWRRSFDTPPPPM 127
            ::.|.:.|.:|..:.|  |:     |.||.:|...|..| |.......|..|..|   |..|   
Zfish    67 EIILGNNLHSSATEMILDPL-----LRERGFGVAEGRPK-EHLKNMANAAGQSCR---DYTP--- 119

  Fly   128 EPGHPYYENIVKDPRYAEGPKPEEFPQFESLKLTIER----------TLPYWND--VIIPQMKEG 180
             ||....|.:           ...|..|  ||...:|          ::|...|  ||.....:|
Zfish   120 -PGGETLEQV-----------KTRFKMF--LKSLFQRMFEEHGSALSSVPSEADQPVIAGLADDG 170

  Fly   181 KR-----ILIAAHGNSLRGIVKHLDNLSEDAIMALNLPTGIPFVYELDENFKPVVS---MQFLGD 237
            .:     .|:.:||..:|..|:|   |.||  :...||.|:    ::::.|.|..:   .:|:..
Zfish   171 AQNVPVHALMVSHGAFIRISVRH---LVED--LQCCLPAGL----KMNQVFSPCPNTGISRFIFT 226

  Fly   238 EETVKKAIEAVAAQG 252
            ....:..:.|...||
Zfish   227 IHREESVLRATRIQG 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pglym78NP_001034075.1 HP 5..255 CDD:299704 71/275 (26%)
tigarbNP_956485.1 His_Phos_1 6..226 CDD:278716 68/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0588
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.