DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pglym78 and Tigar

DIOPT Version :9

Sequence 1:NP_001034075.1 Gene:Pglym78 / 43447 FlyBaseID:FBgn0014869 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_795977.1 Gene:Tigar / 319801 MGIID:2442752 Length:269 Species:Mus musculus


Alignment Length:282 Identity:68/282 - (24%)
Similarity:119/282 - (42%) Gaps:57/282 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KYKIVMVRHGESEWNQKNQFCG-WYDANLSEKGQEEALAAGKAVKDAGLEFDVAHTSVLTRAQVT 67
            ::.:.::||||:..|::....| ..||.|||.|..:|.|||:.:  :.::|..|.:|.|||.:.|
Mouse     3 RFALTVIRHGETRLNKEKIIQGQGVDAPLSETGFRQAAAAGQFL--SNVQFTHAFSSDLTRTKQT 65

  Fly    68 LASILKASGH-KEIPIQKTWRLNERHYGGLTG--LNKAETAAKYGEAQVQIWRRSFDTPP--PPM 127
            :..||:.|.. |::.::...||.||.||...|  |::....||....:..::     |||  ..:
Mouse    66 IHGILEKSRFCKDMAVKYDSRLRERMYGVAEGKPLSELRAMAKAAGEECPMF-----TPPGGETV 125

  Fly   128 EP----GHPYYENIVKDPRYAEGPKPEEFPQFESLKLTIERTLPYWNDVIIPQMKEGK------- 181
            |.    |..:::.|.:......|.:....|......|  |.:|.    .:.|..|.|.       
Mouse   126 EQVKMRGKDFFDFICQLILGKAGQRESVLPGAPGSGL--ESSLA----EVFPVGKHGSLGANPKG 184

  Fly   182 -------RILIAAHGNSLRGIVKHLDNLSEDAIMALNLP--------------TGIP-FVYELDE 224
                   .||:.:||..:|.:..:.  ||:   :..:||              |||. |:.:.:|
Mouse   185 GTLGLAASILVVSHGAYMRSLFGYF--LSD---LRCSLPGARDKLELSSITPNTGISVFIIDCEE 244

  Fly   225 NFKPVVSMQFLGDEETVKKAIE 246
            ..:|.:....:..:|.:....|
Mouse   245 ARQPSIQCVCMNLQEHLNGVTE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pglym78NP_001034075.1 HP 5..255 CDD:299704 68/281 (24%)
TigarNP_795977.1 His_Phos_1 6..241 CDD:278716 64/252 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0588
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.