DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pglym78 and gpm1

DIOPT Version :9

Sequence 1:NP_001034075.1 Gene:Pglym78 / 43447 FlyBaseID:FBgn0014869 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_594889.1 Gene:gpm1 / 2542085 PomBaseID:SPAC26F1.06 Length:211 Species:Schizosaccharomyces pombe


Alignment Length:223 Identity:98/223 - (43%)
Similarity:129/223 - (57%) Gaps:28/223 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IVMVRHGESEWNQKNQFCGWYDANLSEKGQEEALAAGKAVKDAGLEFDVAHTSVLTRAQVTLASI 71
            :|:.||||||||:.|.|.||.|..|||.|.:||...|:.:|..|.:||:|.||.|.|||.|...|
pombe    10 LVLTRHGESEWNKLNLFTGWKDPALSETGIKEAKLGGERLKSRGYKFDIAFTSALQRAQKTCQII 74

  Fly    72 LKASGHKEIPIQKTWRLNERHYGGLTGLNKAETAAKYGEAQVQIWRRSFDTPPPPMEPGHPYYEN 136
            |:..|...:...|:.:||||:||.|.||||.:...|:|..||||||||:|..|            
pombe    75 LEEVGEPNLETIKSEKLNERYYGDLQGLNKDDARKKWGAEQVQIWRRSYDIAP------------ 127

  Fly   137 IVKDPRYAEGPKPEEFPQFESLKLTIERTLPYWNDVIIPQMKEGKRILIAAHGNSLRGIVKHLDN 201
                            |..||||.|.||.|||:...|:|.:.:|:::||||||||||.::..|:.
pombe   128 ----------------PNGESLKDTAERVLPYYKSTIVPHILKGEKVLIAAHGNSLRALIMDLEG 176

  Fly   202 LSEDAIMALNLPTGIPFVYELDENFKPV 229
            |:.|.|:...|.||:|.||.||::.|.|
pombe   177 LTGDQIVKRELATGVPIVYHLDKDGKYV 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pglym78NP_001034075.1 HP 5..255 CDD:299704 98/223 (44%)
gpm1NP_594889.1 HP 7..210 CDD:299704 98/223 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 164 1.000 Domainoid score I949
eggNOG 1 0.900 - - E1_COG0588
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 182 1.000 Inparanoid score I1111
OMA 1 1.010 - - QHG61896
OrthoFinder 1 1.000 - - FOG0000615
OrthoInspector 1 1.000 - - otm47266
orthoMCL 1 0.900 - - OOG6_101500
Panther 1 1.100 - - LDO PTHR11931
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R933
SonicParanoid 1 1.000 - - X392
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.