DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pglym78 and pgam1

DIOPT Version :9

Sequence 1:NP_001034075.1 Gene:Pglym78 / 43447 FlyBaseID:FBgn0014869 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001119984.1 Gene:pgam1 / 100144939 XenbaseID:XB-GENE-1007742 Length:254 Species:Xenopus tropicalis


Alignment Length:251 Identity:167/251 - (66%)
Similarity:207/251 - (82%) Gaps:1/251 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YKIVMVRHGESEWNQKNQFCGWYDANLSEKGQEEALAAGKAVKDAGLEFDVAHTSVLTRAQVTLA 69
            ||||::|||||.|||:|:||||:||:|||.||:||.:.|:|:||||.|||:..||||.||..||.
 Frog     4 YKIVLIRHGESSWNQENRFCGWFDADLSETGQQEAKSGGQALKDAGYEFDICFTSVLKRAIRTLW 68

  Fly    70 SILKASGHKEIPIQKTWRLNERHYGGLTGLNKAETAAKYGEAQVQIWRRSFDTPPPPMEPGHPYY 134
            .:|:......:|:.:|||||||||||||||||||||||:||.||:|||||||.|||.|:|.|.||
 Frog    69 IVLEGIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFDIPPPSMDPDHDYY 133

  Fly   135 ENIVKDPRYAEGPKPEEFPQFESLKLTIERTLPYWNDVIIPQMKEGKRILIAAHGNSLRGIVKHL 199
            ..|.||.|||:..: ::.|..||||.||.|.||:||:.|:|.:|:|||:|||||||||||||||:
 Frog   134 SIISKDRRYADLTE-DQLPSCESLKDTIARALPFWNEEIVPLIKQGKRVLIAAHGNSLRGIVKHI 197

  Fly   200 DNLSEDAIMALNLPTGIPFVYELDENFKPVVSMQFLGDEETVKKAIEAVAAQGKAK 255
            :.:|::||||||||||:|.:||||:|.||:..||||||||||:||:||||||||||
 Frog   198 EGMSDEAIMALNLPTGVPIIYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pglym78NP_001034075.1 HP 5..255 CDD:299704 165/249 (66%)
pgam1NP_001119984.1 gpmA 4..253 CDD:184516 165/249 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 176 1.000 Domainoid score I3548
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37647
Inparanoid 1 1.050 354 1.000 Inparanoid score I2197
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D496634at33208
OrthoFinder 1 1.000 - - FOG0000615
OrthoInspector 1 1.000 - - mtm9531
Panther 1 1.100 - - LDO PTHR11931
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X392
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.160

Return to query results.
Submit another query.